KEGG   Oryctolagus cuniculus (rabbit): 100101556Help
Entry
100101556         CDS       T03373                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04114  Oocyte meiosis
ocu04217  Necroptosis
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04740  Olfactory transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04934  Cushing syndrome
ocu04971  Gastric acid secretion
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05214  Glioma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100101556 (CAMK2G)
   04310 Wnt signaling pathway
    100101556 (CAMK2G)
   04066 HIF-1 signaling pathway
    100101556 (CAMK2G)
   04020 Calcium signaling pathway
    100101556 (CAMK2G)
   04024 cAMP signaling pathway
    100101556 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100101556 (CAMK2G)
   04217 Necroptosis
    100101556 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100101556 (CAMK2G)
   04922 Glucagon signaling pathway
    100101556 (CAMK2G)
   04912 GnRH signaling pathway
    100101556 (CAMK2G)
   04921 Oxytocin signaling pathway
    100101556 (CAMK2G)
   04916 Melanogenesis
    100101556 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    100101556 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100101556 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    100101556 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    100101556 (CAMK2G)
   04728 Dopaminergic synapse
    100101556 (CAMK2G)
   04720 Long-term potentiation
    100101556 (CAMK2G)
   04722 Neurotrophin signaling pathway
    100101556 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    100101556 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    100101556 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    100101556 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100101556 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100101556 (CAMK2G)
   05205 Proteoglycans in cancer
    100101556 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    100101556 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    100101556 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100101556 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100101556 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100101556 (CAMK2G)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100101556 (CAMK2G)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100101556 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 100101556
NCBI-ProteinID: NP_001093423
Ensembl: ENSOCUG00000012578
UniProt: O77707
Position
18
AA seq 518 aa AA seqDB search
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRATVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKISLVSPAQEPAPLQTAMEPQTTVV
HNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSF
EPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDG
QGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagctcttcgaggagctc
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaagagtat
gcagcaaaaatcatcaataccaagaagttgtctgcccgagatcaccagaagctagaacgt
gaggcccggatatgccgacttctgaaacacccaaacatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgttcgacctcgtcactggaggggagctgtttgaa
gacattgtggccagagagtactacagcgaggcagacgccagccactgtatacaccagatt
ctggagagtgttaaccacattcaccagcatgacattgtacacagggacctgaagcctgag
aacttgctgctggcgagtaaatgcaagggtgccgccgtcaagctggctgactttggcctc
gccatcgaagtacagggagagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccgtatggaaaacctgtggatatctgggcttgc
ggggtcatcctgtatatcctcctggtgggataccctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaggctggagcctatgatttcccatcgccagaatgggatacg
gtgactcctgaagccaagaacttgatcaaccagatgttgaccataaacccggcaaagcgc
atcacggctgaccaggctctcaagcacccatgggtctgccaacgagccacggtggcttcc
atgatgcatcgccaggagaccgtggagtgcttgcgcaagttcaatgcccggaggaaactg
aagggtgccatcctcacgaccatgctggtctccaggaacttctcagctgccaaaagccta
ttgaacaagaagtcggatggtggtgtcaagccacagagcaacaacaaaatcagtctcgta
agcccagcccaagagcccgcgcccttgcagacggccatggagccacaaactaccgtggtg
cacaacgctacagatgggatcaagggctccacagagagctgcaacaccactacagaagat
gaggacctcaaagtgcgaaaacaggagatcattaagatcacagaacagctgattgaagcc
atcaacaatggggactttgaggcctacacgaagatttgtgatccgggcctcacttccttt
gagccggaggcccttggtaacctcgtggaggggatggatttccataagttttactttgag
aatctcctgtccaagaacagcaagcccatccataccaccatcctaaacccacatgtccac
gtgatcggagaggacgcagcttgcatcgcctacatccgcctcacccagtacatcgacggg
cagggtcggccccgcaccagccagtcggaggagacccgggtctggcaccgccgggatggc
aagtggctcaatgtccactaccactgctcaggggcccctgccgcaccgctgcagtga

DBGET integrated database retrieval system