KEGG   Oryctolagus cuniculus (rabbit): 100328948Help
Entry
100328948         CDS       T03373                                 

Definition
(RefSeq) cytochrome P-450
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00140  Steroid hormone biosynthesis
ocu00590  Arachidonic acid metabolism
ocu00830  Retinol metabolism
ocu01100  Metabolic pathways
ocu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100328948
   00590 Arachidonic acid metabolism
    100328948
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100328948
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    100328948
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ocu00199]
    100328948
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100328948
Cytochrome P450 [BR:ocu00199]
 Cytochrome P450, animal type
  CYP2 family
   100328948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100328948
NCBI-ProteinID: NP_001164602
Ensembl: ENSOCUG00000022951
UniProt: P00178
Position
Un
AA seq 491 aa AA seqDB search
MEFSLLLLLAFLAGLLLLLFRGHPKAHGRLPPGPSPLPILGNLLQMDRKGLLRSFLQLRE
KYGDVFTVYLGSRPVVVLCGTDAIREALVDQAEAFSGRGKIAVVDPIFQGYGVIFANGER
WRALRRFSLATMRDFGMGKRSVEERIQEEARCLVEELRKSKGALLDNTLLFHSVTSNIIC
SIVFGKRFDYKDPVFLRLLDLFFQSFSLISSFSSQVFELFPGFLKHFPGTHRQIYRNLQE
INTFIGQSVEKHRATLDPSNPRDFIDVYLLRMEKDKSDPSSEFHHQNLIITVLSLFFAGT
ETTSTTLRYGFLLLLKYPHVTERVQKEIEQVIGSHRPPALDDRAKMPYTDAVIHEIQRLG
DLIPFGVPHTVTKDTQFRGYVIPKNTEVFPVLSSALHDPRYFETPNTFNPGHFLDANGAM
KRNEGFMPFSLGKRICLGEGIARTELFLFFTTILQNFSIASPVPPEDIDLTPRESGVGNV
PPSYQIRFLAR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagttcagcctgctcctcctcctggctttcctcgcaggcctcctgctgcttctgttc
aggggccaccccaaggcccacggccgccttccccccggaccctcccctctgcccatcctg
gggaaccttctgcagatggacaggaagggcctgctccgctccttcctgcagctccgagag
aaatacggggacgtgttcacggtgtacctgggatccagacccgtggtcgtgctgtgtggg
acggatgccatccgcgaggccctcgtggaccaagcagaggccttttctggcagggggaag
atcgccgtggtggatccgatcttccagggatacggagtgatctttgccaacggggagcgc
tggcgggcccttcggagattctccctggccaccatgcgggacttcggcatggggaagcgg
agcgtggaggagcgcattcaggaggaggcccggtgtctggtggaggagctgcggaaatcc
aagggagccctcctggacaacaccttgctgttccactcggtcacctccaacatcatctgc
tccattgtctttggaaaacgcttcgactacaaggaccccgtgttcctgaggctgctggac
ctgttcttccagtccttctccctcatcagctccttctccagccaggtgtttgagctcttc
ccgggcttcctaaagcactttcctggcacgcacaggcagatctacaggaacctgcaggag
atcaacactttcatcggccagagcgtagagaagcaccgcgcaaccctggaccccagcaac
cccagggatttcatcgacgtctacctgctccgcatggaaaaagacaagtccgacccaagc
agcgagttccaccaccagaacctcatcatcaccgtgctctcgctcttcttcgccggcacc
gagaccaccagcaccaccctccgctacggcttcctgctcctgctcaagtacccacacgtc
acagagagagtccagaaggagatcgagcaggtgatcggctcccaccgccctccggccctc
gatgaccgagccaaaatgccctacacggacgcggtcatccacgagatccagcggctcggg
gacctcatccccttcggggtgccccacacggtcacaaaagacacgcagttccgaggctat
gtcatccccaagaacacggaagtgttccccgtcctgagctcggctctccatgacccgcgc
tactttgaaacgccgaacactttcaaccccggccactttctggatgccaacggggccatg
aagaggaatgaaggctttatgcccttctccctggggaagcgcatttgtctgggcgaaggc
atcgcgcggaccgagctgttcctcttcttcaccaccatcctgcagaacttctccatcgcc
agccccgtgcctcccgaggacatcgacctcactccccgggagagtggcgtgggcaacgtg
cccccgagctaccagatccgcttcctggcccgctga

DBGET integrated database retrieval system