KEGG   Oryctolagus cuniculus (rabbit): 100338398Help
Entry
100338398         CDS       T03373                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00561  Glycerolipid metabolism
ocu01100  Metabolic pathways
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04923  Regulation of lipolysis in adipocytes
Module
ocu_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100338398 (MGLL)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100338398 (MGLL)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100338398 (MGLL)
  09159 Environmental adaptation
   04714 Thermogenesis
    100338398 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ocu01002]
    100338398 (MGLL)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100338398 (MGLL)
Peptidases [BR:ocu01002]
 Serine Peptidases
  Family S33
   100338398 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Esterase Lipase_3 PGAP1 Thioesterase LIDHydrolase Abhydrolase_5 Abhydrolase_3 DUF1057 Peptidase_S9 Abhydrolase_2 BAAT_C
Motif
Other DBs
NCBI-GeneID: 100338398
NCBI-ProteinID: XP_008258542
Ensembl: ENSOCUG00000007326
Position
9
AA seq 303 aa AA seqDB search
MPEESSPRRTPQSLPYQDLPHLVNADGQYLFCRYWKPTGTPKALVFVSHGAGEHCGRYEE
LAQMLVGLQLLVFAHDHVGHGQSQGERMVVSDFHVFVRDVLQHVDLVQKDHPGVPVFLLG
HSMGGAIAILTAAERPAHFSGMVLISPLVLASPESATTFKVLAAKVLNLVLPNLSLGPID
SSVLSRNKTEVDLYNADPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSKGAYLLMELVNSQERRFKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTAAAGTG
SAP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggagagttccccccggcggaccccgcagagcctgccgtaccaggacctccct
cacctggtcaatgctgatggacagtacctcttctgcaggtactggaaacccacgggcaca
cccaaggcgctggtcttcgtgtctcatggagccggcgagcactgcggccgctacgaggag
ctcgctcagatgctggtggggcttcagctgctggtgttcgcccacgaccacgttggccat
gggcagagccaaggggagaggatggtggtgtccgacttccacgtgttcgtcagggacgtg
ctccagcacgtggacctcgtgcagaaggaccaccccggcgtccccgtcttcctcctgggc
cactccatgggcggtgccatcgccatcctgaccgccgcagagaggccggcccacttctcc
ggcatggtcctgatctcgcctctggttctcgccagtccggagtcagcaacaacgttcaag
gtccttgcagcgaaggtgctcaacctcgtgctgccaaacctgtccctggggcccattgac
tccagcgtgctctcccggaacaagacagaggtggacctgtacaacgcggatccgctcatc
tgccgcgctgggctcaaagtgtgcttcggcatccagctgctcaacgccgtgtcgcgggtg
gagcgggccctgcccaagctgaccctgcccttcctgctgctccagggctccgccgaccgc
ctgtgtgacagcaagggggcctacctgctcatggagctggtcaatagccaggaaagacgc
ttcaagatttacgaaggtgcctaccacgttctccacaaagagcttcctgaagtcaccaac
tccgtcttccacgaaataaacatgtgggtctctcaaaggacagctgcggccgggaccggc
tccgcgccctga

DBGET integrated database retrieval system