KEGG   Oryctolagus cuniculus (rabbit): 100338471Help
Entry
100338471         CDS       T03373                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04080  Neuroactive ligand-receptor interaction
ocu04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100338471 (HTR4)
   04024 cAMP signaling pathway
    100338471 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100338471 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100338471 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100338471 (HTR4)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100338471 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 100338471
NCBI-ProteinID: XP_008253443
Ensembl: ENSOCUG00000017309
UniProt: G1TDF4
Position
3
AA seq 388 aa AA seqDB search
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGILDLIEKRKFNQNSN
STYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSEGRP
QPADQHNTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGKVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPGTSPLVASQTSDT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacttgatgctaatgtgagttccaaggagggtttcgggtcagtggagaaggtt
gtgctgctcacgtttctctcagctgttatactgatggccatcctgggcaatctgctggtg
atggtggctgtgtgcagagacaggcagctcaggaaaataaaaaccaattatttcattgta
tctcttgcctttgcggatctgctggtttccgtgctggtgatgccctttggtgccattgag
ctggtccaagacatctggatttatggggagatgttctgcctggtccgcacatctttggac
gtcctgctcacaacggcatcaatttttcacctgtgctgcatttctctggataggtattat
gccatctgctgccagcctttggtctataggaacaagatgacgcctctgcgcatcgccttg
atgttgggaggctgctgggtcatccccatgtttatctcttttctccctattatgcaaggc
tggaataatattggcatacttgatttgatagaaaaaaggaagttcaaccagaactctaac
tccacgtactgtatcttcatggtcaacaagccctacgctatcacctgctctgtggtggcc
ttctacatcccgtttctcctcatggtgctggcctattatcgcatctatgtcacagctaag
gagcatgcccaccagatccagatgttacaacgagcaggagcctcctcagagggcaggccc
cagccggcagaccagcataacacccatcgcatgaggacagagaccaaagcggccaagacc
ctgtgcatcatcatgggttgcttctgcctctgctgggctccattctttgtcaccaatatt
gtggatcctttcatagactacactgtccctgggaaggtgtggactgccttcctctggctt
ggctatatcaattctgggttgaacccctttctctacgccttcttgaataagtcttttaga
cgtgccttcctcattatcctttgctgtgatgatgagcgctaccgaagaccttctattctg
ggccagacagtcccctgttcaaccacaaccattaatggatccactcatgtactaagggat
gcagtggagtgtggaggccagtgggagagtcaatgccaccctccaggaacttctcccttg
gtggcttctcaaaccagtgacacttag

DBGET integrated database retrieval system