KEGG   Oryctolagus cuniculus (rabbit): 100338634Help
Entry
100338634         CDS       T03373                                 

Gene name
MAPK15
Definition
(RefSeq) mitogen-activated protein kinase 15
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100338634 (MAPK15)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100338634 (MAPK15)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100338634 (MAPK15)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100338634 (MAPK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 100338634
NCBI-ProteinID: XP_008251927
Ensembl: ENSOCUG00000017881
Position
Un
AA seq 593 aa AA seqDB search
MCAAEVDAHIARRFRLQRRLGKGAYGIVWKAVDRSTGEVVAIKKIFDAFRDQTDAQRTFR
EIVLLQEFGGHPNIIRLLDVIRAENDRDIYLVFESMDTDLHAVIEKGTLLKDIHKRYIFY
QLLRATQFLHSGHVVHRDQKPSNVLLDANCLVKLCDFGLARSLSSVPEGPEGQPLTEYVA
TRWYRAPEVLLSSHWYTPGVDMWSLGCILGEMLRGRPLFPGTSTLHQLQLILEAVPPPSE
EDLLALGSNYSSLVLHHLGSRPRQLLDALLPPDTPPQALDLLRRLLVFAPDKRLSAAQAL
QHPYVQRFHCPGQEWTRDAAFQLPVPAGVQLSATEYRNRLYQMLLERRGSGGLGGAAPEP
GAAPQEPGRRHRSSGGRAPEREAPRAATSKSRQRPAPLLQLPPPGRRARPPAPAAEAPLA
PAGVVSRAAGAGGASHCALGAAPAAPSQGRPAPSLTSQAVAQAANRALIRSDQTRVSGLR
AAGGLRGSRGPGPPAPPLLSPARSRPLPGAQAPPRDAPEPRPGRRMLGSTSALQGAQGAA
RAALGGYSQAYGTVCRSALDCLPLLPRPAPEPPRGNSRTCSVLLPNPVPAPLQ
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgccgccgaggtggacgctcacatagcgcggagattccggctgcagcggcggctg
ggcaagggggcctacggcattgtttggaaggcagtggaccggagcaccggcgaggtcgtg
gccatcaagaagatcttcgatgccttcagagaccagacggatgcccagaggaccttccgg
gagatcgtgctcctgcaggagtttggaggccaccccaacatcatccgcctgctggacgtg
atccgagccgagaacgacagggacatctacctggtgtttgagtctatggacacggacctg
cacgcggtcattgagaagggcacgctgttgaaagacatccacaaacgctacatcttctac
cagctcctgcgggccacgcagttcctccactcgggccacgtcgtccaccgggaccagaag
ccatccaacgtcctgctggacgccaactgcctggtgaagctctgcgactttggcctggcc
cggtcgctgagcagtgtccccgaggggcccgagggccagccgctgacggagtacgtggcc
acacgctggtaccgggcgccggaggtgctgctgtcctcacactggtacaccccgggggtg
gacatgtggagcctgggctgcatcctgggggagatgctgcgagggcggcccctgttccca
ggcacgtccacgctgcaccagctgcagctgatcctggaggccgtccccccgccctccgag
gaggacctcctggctctcggctcaaactacagttccttggtcctgcaccatctggggtcc
cggcctcggcagctgctggacgcccttctgccgccggacaccccgccgcaggccctggat
ctcctccggcgactgctggtgttcgccccggacaagcgcctgagcgccgcgcaggccctg
cagcacccctacgtgcagaggttccactgccccggccaggagtggacacgggatgcggcc
tttcagcttccggtgcccgcaggggtccagctctctgcgactgagtatcgcaaccggctc
tatcagatgctgctggagcgcaggggcagcggcggcctggggggcgcagcccctgaaccc
ggagcggccccgcaggagccgggacgcaggcatcggagcagcggcgggcgcgcgcccgag
cgcgaggccccccgcgccgccacgagcaagtcccggcagcgccccgcacccctgctccaa
cttccacccccagggaggcgggctcggccccctgcgccggcggcggaggcccccttggca
ccagcgggggtggtaagtcgtgcggcgggcgccggcggcgcctcccattgcgccctgggt
gccgctccggctgctccttcccaggggaggccggcgccctccctgacctcgcaggctgtg
gcccaggcggccaaccgggccctgatccgcagcgaccagacgcgggtcagtgggctgcgg
gccgctggcgggctccgcgggagccggggcccaggccctcctgctccacctctgctctcc
ccggcgcgctcccgaccactgcccggagcgcaggcccctcccagggatgccccggagcct
cggccgggccgcaggatgctgggcagcacctccgcgctacagggcgcccagggcgctgcc
agggctgcgctcgggggctactcccaggcctatggcacagtctgccgctcggcactggac
tgcctgcccctgcttccccgccctgcacctgagccgccacgcgggaactcccggacctgc
tcagtgcttcttcccaacccagtcccggcccccctccaataa

DBGET integrated database retrieval system