KEGG   Oryctolagus cuniculus (rabbit): 100339155Help
Entry
100339155         CDS       T03373                                 

Gene name
FKBP5
Definition
(RefSeq) FK506 binding protein 5
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100339155 (FKBP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100339155 (FKBP5)
Enzymes [BR:ocu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100339155 (FKBP5)
Chaperones and folding catalysts [BR:ocu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    100339155 (FKBP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_8 TPR_6 TPR_19 TPR_7 TPR_12 TPR_9 Fis1_TPR_C TPR_11 ANAPC3 TPR_14 TPR_16 PknG_TPR NARP1 FKBP_N_2
Motif
Other DBs
NCBI-GeneID: 100339155
NCBI-ProteinID: XP_002714685
Ensembl: ENSOCUG00000005513
UniProt: G1SP30
Position
12
AA seq 457 aa AA seqDB search
MTTDEGAKNNGESPAATVAEQGEDITSKQDRGVLKIVKRVGNSEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDAGIIRRIKRKGEGYSNPNEGATVEIHLEGCCGGRM
FDCRDVVFVVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYAKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISTCQRKAKEHNERDRRIYANMFTKFAEQD
AKEEASKAMGKKTSQGVPGEKRTESQAMEEEKPAGHV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgactactgatgaaggtgccaagaacaatggagaaagcccagcagccactgttgctgaa
cagggagaggatattacctccaaacaagacaggggcgtgttaaagattgtcaaaagagtg
gggaatagtgaggaaacaccaatgattggagacaaagtttatgtccattacaaaggaaaa
ttgtcaaatggaaagaaatttgattccagtcatgatagaaatgaaccgtttgttttcagt
cttggcaaaggtcaagttatcaaggcatgggacattggggtggccaccatgaagaaagga
gagatctgccacttgctgtgcaagccagaatatgcatatggctctgctggcagtctcccc
aaaattccctccaatgcaacgctcttttttgagattgagctccttgatttcaaaggagag
gatttatttgaagatgcaggtatcattcgcagaatcaaacgaaagggagagggatattca
aacccaaacgaaggagcaacagtggaaatccacctggaaggctgctgcggtggaaggatg
tttgactgcagagacgtggtcttcgttgtgggcgaaggagaagaccacgacattccgatt
ggaatcgacaaagcgctggagaaaatgcagcgggaagaacagtgcattttatacctcgga
ccacgatatggttttggagaggcagggaagcctaaatttggcattgaacctaatgctgag
cttatatatgaagttacacttaagagcttcgaaaaggccaaagaatcctgggagatggat
accaaagaaaagttggagcaggctgccattgtcaaagagaagggaactgtgtacttcaag
ggaggcaagtacatgcaggcggtgattcagtatgggaagatagtgtcctggctagagatg
gagtatggcttatcagaaaaggaatcgaaagcttcggagtcgtttctgctcgccgccttt
ctgaatctggccatgtgctacctgaagctccgagagtacgccaaagctgttgaatgttgc
gataaggccctgggactggacagtgccaatgagaaaggcctgtacaggaggggtgaggcc
cagctactcatgaatgagtttgagtcagccaaaggggactttgagaaagtgctggaagtc
aacccccagaacaaggccgcacgactgcagatctccacctgccagcgcaaggccaaggag
cacaacgagcgggaccgcaggatctacgccaacatgttcaccaagtttgccgagcaggat
gccaaggaagaggccagtaaagcaatgggcaagaagacgtcgcaaggggtccccggcgaa
aaacgcaccgaaagccaagcgatggaagaagagaagcctgcaggccacgtatga

DBGET integrated database retrieval system