KEGG   Oryctolagus cuniculus (rabbit): 100340775Help
Entry
100340775         CDS       T03373                                 

Gene name
PLA2G4D
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00564  Glycerophospholipid metabolism
ocu00565  Ether lipid metabolism
ocu00590  Arachidonic acid metabolism
ocu00591  Linoleic acid metabolism
ocu00592  alpha-Linolenic acid metabolism
ocu01100  Metabolic pathways
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04217  Necroptosis
ocu04270  Vascular smooth muscle contraction
ocu04370  VEGF signaling pathway
ocu04611  Platelet activation
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04724  Glutamatergic synapse
ocu04726  Serotonergic synapse
ocu04730  Long-term depression
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04921  Oxytocin signaling pathway
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100340775 (PLA2G4D)
   00565 Ether lipid metabolism
    100340775 (PLA2G4D)
   00590 Arachidonic acid metabolism
    100340775 (PLA2G4D)
   00591 Linoleic acid metabolism
    100340775 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    100340775 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100340775 (PLA2G4D)
   04010 MAPK signaling pathway
    100340775 (PLA2G4D)
   04370 VEGF signaling pathway
    100340775 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    100340775 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100340775 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100340775 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    100340775 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    100340775 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100340775 (PLA2G4D)
   04913 Ovarian steroidogenesis
    100340775 (PLA2G4D)
   04921 Oxytocin signaling pathway
    100340775 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100340775 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    100340775 (PLA2G4D)
   04726 Serotonergic synapse
    100340775 (PLA2G4D)
   04730 Long-term depression
    100340775 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100340775 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100340775 (PLA2G4D)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100340775 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2 Rad52_Rad22
Motif
Other DBs
NCBI-GeneID: 100340775
NCBI-ProteinID: XP_008267359
Ensembl: ENSOCUG00000013994
UniProt: G1T6I8
Position
17
AA seq 821 aa AA seqDB search
MESLSPKGPPGHPQQGETSACWRLTVTVLRARSLRRTDLLSEADAYVLLQLPTAPGMKLR
TRTVANSSHPVWNETFSFLVQRQVKNVLELSIYDEDSATEDDICFKCLYDVSEVLPGQRL
RKTFSQSPQAQEELDVEFLMEQALDRPENLVTNQVLVARELSCLDVRLDRAGSTSAVADQ
DKLELELVLKGSYEDTQTSVLGTASAFRFHYLAAQETELHGRLRGSTSNGWNSHGSAGHL
TLPLKSLATGKEVTVDVPATNGPGVRLQLKAGACPEELAVRLGFDLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIAATGGGARAMTSLYGHLLGLQKLGLLDCVTYFSGV
SGSTWAMAHLYGDPEWSQKDLKGPISHAREHLAKSKLDAFSPARLASYKRELELRAERGH
PTTFVDLWALVLEFMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEAGFLKYGAFVPPELFGSEFFMGRLMRRLPEPRICFLEGIWSNIFSLNLLDAWH
DLGSSGEAWTHHLKDKIRNMAAEKERPPASPQPSSWMEASWLQPGTALAQALKGFLTGRP
LHQHSTNFLQGLQLHQDYYSQRDFSTWADSPLDSTPGQLTPQEPQLCLVDAGYFINTSCP
CMFRPGRKLDLILSFDYSLSSHFEALQQTELYCRARGLPFPHMQPSPQDQRQPGECHLFS
DPTCPEAPVLLHFPLVNASFKDHSAPGVRRSPAELQAGQVDLTGPTSPYALFNMTYKEED
FDHLLQLSDYNVRNSQDAILQALRAALKHRASGLRPPGAQT
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggagagcctgtcccctaagggaccgccaggccatcctcagcagggggagacctctgcc
tgctggcggctcaccgtgacagtgctgagggcgcggagcctgcgccggacagacctgttg
agcgaggctgacgcctatgtgctcctgcagctgccaaccgcacctggaatgaagctcagg
accagaacagtcgccaactctagtcatcctgtgtggaacgagaccttcagtttcctagtc
cagagacaggtcaagaatgttctagagctgagcatctatgatgaggactcagcgacggag
gatgacatctgcttcaagtgtctctacgatgtctcagaagtcctccctggccagcggctc
cggaagaccttctcccagagtccccaggcccaggaagagctggacgtggagttcctgatg
gaacaagcgttagaccgtccggaaaacctcgtcaccaaccaagtgcttgtggcccgggag
ctatcctgcctggatgtgcgtctggacagagcaggcagcacttcagcggtggcagatcag
gacaagctggagctggagctggtgctgaaggggtcctatgaggacacgcagacgtctgtc
ctgggcacagcctctgccttccgcttccactacctggcggctcaagagacggagctgcat
gggcgcctgaggggctccacgagcaatggctggaactcccatggctcagctggacacctc
actctgcccctgaagtccctggccacggggaaggaggtgactgtggatgttcccgctaca
aacggcccaggagtgaggctgcagctcaaggcaggggcctgccccgaggagctggcggta
cggctgggcttcgacctctgtgcggaggagcaggccttcctgagcaggcggaagcaggtg
gtggccaaggccctgaagcaggccctgcagctggacagagacctgcaggaggatgaggtt
cccgtcgtgggcattgcggccacaggaggcggcgccagggccatgacctcactctacggc
cacctcttgggtctgcagaagctcggcctcctggactgtgtgacctacttcagtggcgtt
tcaggctcaacctgggcaatggctcacctgtacggggaccctgagtggtcacagaaggac
cttaagggacccatcagccacgcccgggagcacctggccaagagcaagctggacgccttc
tccccggcgcgcctggcgagctacaagcgggagctggagctgagggctgagcggggccac
cccacgacctttgtggatctgtgggccctggtgctggagttcatgctgcatggtcaggtg
atggaccagaagctgtcgggacagagagctgcgctggagcgggggcagaaccccctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagaccctcgacttcaaagagtgg
gtggagttctccccctacgaggccgggttcctcaagtacggcgccttcgtcccccctgag
ctcttcggctccgagttcttcatggggcggctgatgaggaggctgcctgagccccgcatc
tgctttctggaaggtatctggagcaacattttctccctgaacttgctggatgcttggcat
gacctcggcagctctggcgaggcctggacacaccacctcaaggacaagatcaggaacatg
gctgcagagaaggagcgcccccctgcctccccacagccctcctcctggatggaggcgtcg
tggctgcagcccggcacggccctggcccaggcattgaagggcttcctgacgggcaggcca
ctccaccagcacagcaccaacttcctccagggcctgcagctgcaccaggactactacagc
cagagggacttctccacctgggcagacagtccgctggattccacccctggccagctgact
ccccaggagccccagctctgcctggtggacgccggctacttcatcaacaccagctgcccc
tgcatgttccggccaggccgaaagctggacctcattctctccttcgactactccctgtcc
tcgcactttgaggcactgcagcagacggagctgtactgccgagcccgcgggctgcccttc
ccccacatgcagcccagcccccaggaccagcgccagccgggcgagtgccacctcttctca
gaccccacctgccccgaggcccctgtcctgctgcacttcccgctggtcaacgcctccttc
aaggaccactcggcccctggtgtccggcgcagccctgcagagctccaggctggccaagtg
gacctcaccgggcctacctccccctatgccctcttcaacatgacctacaaggaggaagac
tttgaccacctgctgcagctcagtgactacaacgtgcggaacagccaggatgccatcctg
caggccttgagggccgctctgaagcatcgggcctcggggctgcggcctccaggggcacag
acctga

DBGET integrated database retrieval system