KEGG   Oryctolagus cuniculus (rabbit): 100341099Help
Entry
100341099         CDS       T03373                                 

Gene name
GPX6
Definition
(RefSeq) glutathione peroxidase 6
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00480  Glutathione metabolism
ocu00590  Arachidonic acid metabolism
ocu01100  Metabolic pathways
ocu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100341099 (GPX6)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100341099 (GPX6)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100341099 (GPX6)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100341099 (GPX6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 100341099
NCBI-ProteinID: NP_001243835
Ensembl: ENSOCUG00000016829
UniProt: G1TCG2
Position
12
AA seq 221 aa AA seqDB search
MIPQFWASCLFLLFLVSFAQETPEPQKMKMDCNKEVSGTIYEYGARTLNGEEDIQFQQYA
GKYVLFVNVATYCANTAQYPELNRLQEDLKNLSVIVLGFPCNQFGKQEPGRNSEILSGLK
YVRPGGNFVPNFQLFEKGDVNGENEQKVFTFLKNSCPPTSELLGSPRHLFWDPLKIHDIR
WNFEKFLVGTDGIPVMRWFHAAPVSTVKADILKYVEQFNTQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcagttctgggcctcctgtcttttcctgctgttcctggtcagctttgctcag
gaaaccccggagccgcaaaagatgaagatggattgcaacaaagaggtgtcaggtaccatc
tatgagtacggagcccgcaccctcaatggtgaagaagacatccagttccagcagtatgcc
gggaagtacgtgctctttgtcaacgtggccacctactgcgccaacacagctcagtatcct
gaactgaatagactacaggaggacctgaagaaccttagtgtcattgtgctgggctttcct
tgcaaccagtttggaaaacaagaaccaggaaggaactcagagatcctttctgggctcaag
tacgtgcgtccaggtggtaactttgtccccaatttccagctctttgagaaaggggatgtg
aatggagaaaacgaacagaaggtctttaccttcctgaagaactcttgccctccgacgtct
gaacttttgggctccccacgccacctcttctgggatcccttgaagatccatgacatccgc
tggaacttcgagaaattcttggtgggcactgatggaatccctgtcatgcgctggttccat
gcggctcccgttagcactgtcaaagcagacatcctcaaatatgtagagcagttcaacacc
cagtag

DBGET integrated database retrieval system