KEGG   Oryctolagus cuniculus (rabbit): 100341425Help
Entry
100341425         CDS       T03373                                 

Gene name
MARS2
Definition
(RefSeq) methionyl-tRNA synthetase 2, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00450  Selenocompound metabolism
ocu00970  Aminoacyl-tRNA biosynthesis
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100341425 (MARS2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100341425 (MARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ocu01007]
    100341425 (MARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ocu03016]
    100341425 (MARS2)
Enzymes [BR:ocu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100341425 (MARS2)
Amino acid related enzymes [BR:ocu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100341425 (MARS2)
Transfer RNA biogenesis [BR:ocu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100341425 (MARS2)
 Prokaryotic type
   Other AARSs
    100341425 (MARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 100341425
NCBI-ProteinID: XP_002712314
Ensembl: ENSOCUG00000017798
Position
7
AA seq 612 aa AA seqDB search
MRPSHVLPGHRLRRYGPAGTMLRVCVRPLGRLGTFKVCFQGYVGPRHYSSSSFSGSDDSR
DARAYFTTPIFYVNAAPHIGHLYSALLADALCRHRRLRVPSATATRLSTGTDEHGLKIQQ
AAATAGLAPIELCDRVSSQFQQLFQEAGVSSTDFIRTTEARHRLAVQHFWEVLKARGLLY
KGLYEGWYCASDECFLPEAKVTRQPGPSGESCPVSLESGHPVSWTKEENYIFRLSQFQEP
LRQWLRGNPQTITPEPFYHAVLQWLEEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLD
ALVNYLTVIGYPNDEFKSWWPATSHIIGKDILKFHAIYWPALLLGAGLSPPHRICVHSHW
TVCGQKMSKSLGNVVDPRTCLEHYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELAD
ALGGLLNRCTANRINPSGTYPAFCTTCFPSEPGLMGPSVRARAEDYALVRAVATLPKQVA
DHFDNFQIYKALEAVSSCVRQTNGFVQRHAPWKLNWENPADAPWLGTVLHVALECLRVFG
TLLQPVTPNLADKLLSRLGVSATERSLGKLRFLPRFYGHPCPFEGRRLGPETGLLFPRLD
QSRGWLVKAHRT
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccctcacacgtgctgcccggacaccgcctccgccgatacgggccggccggcacc
atgctgcgtgtttgtgtccggccgttaggacgcctggggacctttaaggtttgtttccag
gggtacgttggcccacgccactatagttcgagctcttttagcggcagcgacgattctcgc
gacgcgcgcgcctacttcaccacacccattttctacgtgaacgcggcgccgcacatagga
cacctgtactcggcgctactggcggacgccctgtgccgccaccgtcgcctccgagttccc
agcgccaccgccacgcgactctccaccggtaccgacgagcacggcctgaagattcagcag
gcggctgccacggcgggcctggccccaattgagctgtgcgaccgagtctcttcccagttc
cagcagcttttccaggaggcaggggtctcatcgaccgactttatccgcaccacggaggcc
cggcaccggctggctgtgcagcacttctgggaggtgctcaaggcccgggggctgctgtac
aaggggctctatgaaggctggtattgcgcctcggacgagtgctttctgcctgaggccaag
gtcacccggcagccaggcccgtctggggagtcctgtcctgtatctctagagagcgggcat
ccagtttcttggaccaaggaagaaaactacatttttaggctttcccagttccaggagccg
ctccgacagtggctgcggggcaaccctcagaccatcaccccggagccattctatcacgca
gtccttcagtggctggaggaggagctgccagatctgtcggtgtctcgcaggagtagccac
ttgcattggggcattccggtgcccggggacgactcgcagaccatctacgtatggctggat
gccctggtcaactacctcactgtaattggctacccaaatgatgagttcaaatcttggtgg
ccggctacctctcacatcataggtaaggacattctcaaattccacgccatttattggcct
gccctcctcttaggggctggattgagcccaccacaccgcatctgtgtccactctcattgg
acagtctgtggccaaaagatgtccaagagcttgggcaacgtggtggatcccaggacttgc
cttgaacactatactgtggatggcttccgctactttcttcttcggcagggcgttcccaac
tgggactgtgactattatgatgaaaaggttgttaagttactggattctgagctggcagat
gccttgggaggtctcttgaaccgatgcactgccaacagaataaatccttctgggacctac
ccagctttttgtaccacctgcttccccagtgaaccagggctgatggggccatcagttcgt
gctcgagcagaggactacgctctggtgagagcagtggccactttgcccaagcaggtagca
gaccactttgataattttcagatctataaggctctggaggcagtgtctagttgtgtccgg
caaactaatggttttgtccaaagacatgcgccctggaagttgaactgggagaatccagcg
gatgccccctggctaggtactgtgcttcatgtggccttggaatgtttgcgagtctttgga
actttgcttcagcctgtcaccccaaacctagctgataagctgctgtctaggctgggggtt
tctgccacagagagaagccttggaaagctccgtttcttgcctcgattttatggacatccc
tgcccttttgagggcaggaggctgggacctgaaactgggcttttgtttccaagactggac
cagtcccggggttggctggtgaaagcccacaggacctag

DBGET integrated database retrieval system