KEGG   Oryctolagus cuniculus (rabbit): 100341613Help
Entry
100341613         CDS       T03373                                 

Gene name
ENOSF1
Definition
(RefSeq) enolase superfamily member 1
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00051  Fructose and mannose metabolism
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100341613 (ENOSF1)
Enzymes [BR:ocu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     100341613 (ENOSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C DUF2247
Motif
Other DBs
NCBI-GeneID: 100341613
NCBI-ProteinID: XP_002713637
Ensembl: ENSOCUG00000008678
UniProt: G1SVN0
Position
9
AA seq 443 aa AA seqDB search
MVRGRIIRLSVRDVRFPTSLGGHGSDAMHTDPDYSAAYVVIETDAGDGLAGCGITFTLGK
GTEVVVCAVNALAHHVLHKDLRDIVGDFRGFYRQLTSDGQLRWIGPKKGVVHLATAAVLN
AVWDLWAKQEGKPLWKLLVDMDPRTLLSCIDFRYITDVLTEEDAYDILQQAQVGKKEREE
QMLTHGYPAYTTSCAWLGYSDDTLKQRCAEALKDGWTRFKVKVGADLQDDMRRCRLIRDM
IGPEKTLMMDANQRWDVPEAVEWMSKLAEFKPLWIEEPTSPDDILGHATISKALVPLGIG
VATGEQCHNRVIFKQLLQANALQFLQIDSCRLGSVNENLSVILMAKKFGIPVCPHAGGVG
LCELVQHLIIFDYIAVSASLKNRMCEYVDHLHEHFKYPVTIKQASYMPPKAAGYSTEMKE
ESVKKHQYPEGEVWKRLHAAHEN
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcggcaggataatccggctctcggtccgcgatgtgcgcttccccacgtcgctc
gggggtcacggctcggacgccatgcacacagaccctgactactcagctgcctacgtcgtc
atagagaccgatgcaggagatggactcgcaggatgtggaattaccttcacactggggaaa
ggcactgaagttgttgtctgtgctgtgaatgccctcgcccaccacgtccttcacaaggat
ctcagggacattgtcggtgacttcagaggcttctacaggcagctcacgagtgacgggcag
ctgagatggatcggtcccaagaaaggcgtggtgcacctggccacagcggccgtcctcaac
gccgtgtgggacctgtgggccaagcaggagggaaagcccctatggaagttgcttgtggac
atggaccccaggacgctgttgtcctgcatcgacttcaggtacatcactgacgtcctgacc
gaggaggatgcctacgacatactgcagcaagctcaagttggtaaaaaagaaagagaagag
caaatgctgacacacggctaccctgcttacaccacgtcgtgcgcctggctggggtactca
gatgacacgctgaagcagcgctgcgcagaggcactgaaggacggctggaccaggtttaaa
gtaaaggtgggtgctgatctccaggatgacatgcgccgatgccgcctcatcagagacatg
attggaccagagaagactctgatgatggatgccaaccagcgctgggacgtgcccgaggcg
gtggagtggatgtcaaagctggctgagttcaagccattgtggattgaggagccgacatcc
cccgatgacattctggggcatgctaccatttccaaggcgctggtcccactaggaattggt
gttgccactggggaacagtgccacaatagagtgatatttaagcagctcctacaggcgaat
gccctgcagtttctccagattgacagctgcagactgggaagtgtcaatgagaacctctca
gtgatactgatggccaaaaaatttggaattcctgtttgcccccatgctggtggcgtcggc
ctctgtgaactggtccagcacttgattatatttgactacatagcagtctctgcaagcctt
aaaaacaggatgtgtgaatacgtcgaccacctgcacgagcacttcaagtatcctgtgaca
atcaagcaggcttcctacatgcctcctaaggctgctggctattcaaccgaaatgaaggag
gaatctgtgaagaaacaccagtatccagagggtgaagtctggaagagactccatgccgct
cacgaaaattaa

DBGET integrated database retrieval system