KEGG   Oryctolagus cuniculus (rabbit): 100341888Help
Entry
100341888         CDS       T03373                                 

Gene name
IDE
Definition
(RefSeq) insulin degrading enzyme
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100341888 (IDE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100341888 (IDE)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     100341888 (IDE)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   100341888 (IDE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C Tn916-Xis
Motif
Other DBs
NCBI-GeneID: 100341888
NCBI-ProteinID: XP_008268423
Ensembl: ENSOCUG00000002827
Position
18
AA seq 1019 aa AA seqDB search
MRYRLAWLLHPALPSTFRSILGARLLPSERLCGFQKKTYSKMNNPAIKRIGNNIIKSPED
KREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKK
YPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKD
REVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQE
LLKFHSTYYSSNLMAICVLGRESLDDLTNLVVKLFSEVENKNVPLPEFPEHPFQEEHLRQ
LYKIVPIKDIRNLYVTFPIPDLQQYYKSNPGHYLGHLIGHEGPGKSVIRTXIKGWVNTLV
GGQKEGARGFMFFIINVDLTEEGLLHVEDIILHMFQYIQKLRAEGPQEWVFQECKDLNAV
AFRFKDKERPRDYTSKIAGILHYYPLEEVLTAAYLLEEFRPDLIEMVLNKLRPENVRVAI
VSKSFEGKTDRTEEWYGTQYKQEAIPDEVIKKWQNADLNGKFKLPTKNEFIPTNFEILAL
EKEATPYPALIKDTAMSKLWFKQDDKFFLPKACLNFEFFSPFAYVDPLHCNMAYLYLELL
KDSLNEYAYAAELAGLSYDLQNTIYGMYLSVKGYNDKQPILLKKITEKMATFEIDEKRFE
IIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELKEALDDVTLPRLKAFIPQLL
SRLHIEALLHGNITKQAALSIMQMVEDTLIEYAHTKPLLPSQLVRYREVQLPDRGWFVYQ
QRNEVHNNCGIEIYYQTDMQSTSENMFLELFCQIISEPCFNTLRTKEQLGYIVFSGPRRA
NGIQGLRFIIQSEKPPHYLESRVEAFLITMEKSIEDMTEEAFQKHIQALAIRRLDKPKKL
SAECAKYWGEIISQQYNFDRDNIEVAYLKTLTKDDIIKFYKEMLAVDAPRRHKVSVHVLA
REMDSCPVVGEFPCQNDINLSQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL
NT seq 3060 nt NT seq  +upstreamnt  +downstreamnt
atgcggtaccggcttgcgtggctgctgcaccccgcgctgcccagcactttccgctccatc
ctaggtgcccgcctgctgccctcggagcgcctctgcggtttccaaaaaaagacttacagc
aaaatgaataatccagctatcaagagaataggaaataatattatcaagtctcctgaagac
aagcgagaataccgtgggctagagctggccaatggaatcaaagtgcttctcatcagtgat
cccaccacggataagtcgtcagctgcacttgatgtacatataggttcattgtcagatcct
ccaaatattgctggtttaagtcatttttgtgaacacatgctgtttttgggaacaaagaaa
taccctaaagaaaatgaatacagccagtttctcagtgagcatgcaggaagttctaatgcc
tttactagtggagagcataccaactactattttgatgtttcccatgaacacctagaaggt
gccctcgataggtttgcacagtttttcctgtgccccttgtttgatgaaagttgcaaagac
agagaggtgaacgcagttgattcggaacatgagaagaatgtgatgaatgatgcctggaga
ctctttcagcttgaaaaagctaccgggaatcccaagcaccctttcagcaaatttgggaca
ggtaacaaatacactctagagactcgaccaaaccaagaaggcattgatgtaagacaagag
ctactgaaattccattctacgtattattcatccaacttaatggctatttgtgttttaggt
cgagaatctttagatgacttgactaatctggtggtaaagttgttttctgaagtagaaaac
aaaaatgtcccattaccagaatttcctgaacaccctttccaggaagaacatcttagacaa
ctttacaaaatagtacctattaaggacattaggaatctttatgtgacatttcccataccc
gaccttcagcaatactacaaatcaaatcctggtcactatcttggtcatctcattgggcat
gaaggtcctgggaagtctgttatcagaacttaaatcaagggctgggtaaatactcttgtt
ggtgggcagaaggaaggagcacgaggttttatgttttttatcattaatgtggacttgaca
gaggaaggattattacatgttgaagatataattttgcacatgtttcaatacattcagaag
ttacgtgcagaaggacctcaagaatgggttttccaagagtgcaaggacttgaatgctgtt
gcttttaggtttaaagataaagagaggccacgagactatacatccaaaattgcaggaata
ttgcattattatcctctagaagaagtactcacagctgcatatttgctggaagaatttaga
cctgacttaatagaaatggttctcaataaactcagaccagaaaatgtccgagttgcaata
gtgtccaaatcttttgaaggaaaaactgatcgcacagaagagtggtatggaactcagtac
aagcaagaagctataccagatgaagtcattaagaaatggcaaaatgctgacctaaatgga
aagttcaagcttccaacgaagaatgaatttattcctaccaattttgagattttagcatta
gaaaaagaggcaacaccataccctgctctcattaaggatacagctatgagcaagctctgg
ttcaaacaagatgataagtttttcttgccaaaggcttgtctcaactttgaatttttcagc
ccatttgcttatgtggaccccttgcactgtaacatggcctatttgtaccttgagctcctc
aaagactcgctcaacgagtatgcatatgcagcagaactagcaggcttgagctatgacctc
caaaataccatctatgggatgtatctctcagtgaaaggttacaatgacaagcaaccaatt
ttgctaaagaagattactgagaaaatggctacctttgaaattgacgaaaaaagatttgaa
attatcaaagaggcatacatgcgatctctcaacaatttccgggctgagcagcctcaccag
catgccatgtactacctccgcttgttgatgactgaagtggcttggactaaagatgagtta
aaagaagccctggatgatgtcacccttcctcgccttaaggccttcatccctcagctcctg
tcgcggctgcacattgaagccctcctccatggaaacataacaaagcaggctgcattaagt
attatgcaaatggttgaagacacccttattgaatatgctcatacaaaacctctccttccg
agtcagctggttcggtatagagaagttcagctccctgacagaggatggtttgtttaccag
cagaggaatgaagttcacaacaactgtggcatcgagatatactaccagaccgacatgcag
agcacctcggagaatatgtttctggagctcttctgtcagattatctctgagccttgcttc
aacaccctgcgcaccaaggagcagctgggatatatcgtcttcagtggcccgcgtcgagcc
aatggcatccagggcttgagattcatcatccagtcagaaaagccacctcactacctggaa
agcagagttgaagcttttttaattaccatggaaaagtccatagaggatatgacagaagag
gcctttcagaaacatattcaagcattagcaattcgtcgactagacaaaccaaagaaactg
tctgcagagtgtgctaaatactggggagaaatcatctcccagcaatacaattttgataga
gataacatagaagttgcatatttaaagacacttaccaaggacgatatcatcaaattttac
aaggaaatgttggcagtagatgctccaaggagacacaaggtgtccgtccatgttcttgcc
agggaaatggattcttgtcctgttgttggagagttcccgtgtcaaaatgatataaacttg
tcacaagcaccagccttgccacaacctgaagtgattcagaacatgaccgagttcaaacgt
ggattgcccctctttccccttgtgaagccacatattaacttcatggctgcaaaactctga

DBGET integrated database retrieval system