KEGG   Oryctolagus cuniculus (rabbit): 100343027
Entry
100343027         CDS       T03373                                 

Gene name
ADAMTS13
Definition
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100343027 (ADAMTS13)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100343027 (ADAMTS13)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100343027 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 TSP1_CCN Reprolysin_4 TSP1_spondin Reprolysin_5 Reprolysin_2 Peptidase_M10
Other DBs
NCBI-GeneID: 100343027
NCBI-ProteinID: XP_017195933
Ensembl: ENSOCUG00000004384
Position
Un
AA seq 1462 aa
MSRARPWAGGRRLQVARVRGTLTGALFLLGCGALADFQQAGTVLVGGDRRYLRPEPLPHW
GGARAPETVPGPSRRRRLVAGDILHLELLVAVGADIHQAHQEDTERYVLTNLNIASELLR
DPSLGARFWVHLVGMLILTEPKQGPEVSANITSSLLSVCEWGRTVNPTDDSDPRHADLVL
YVTRFDLELPDGNRQVRGVTQLGGACSPSWSCLITEDTGFDLGVTIAHEIGHSFGLQHDG
APGSSCGPSGHVMASDGAAPARGVLSWSACSRRQLQSLLSAGGARCVRDPPGAAPVRRAP
EGQPGLYYGADQQCRVAFGPSAAACTFAREPLDVCEALSCHTDPLDRSSCSRLLVPLLDG
TPCGVEKWCSKGHCRSLAELTPVAAVHGRWSSWGPPSPCSRSCGGGVATRRRRCDNPRPA
FGGRVCEGADLQAELCNTQACEKTQLDFMSEQCAQTDSQPLRLSPDSASFYHWEAAARYS
RGDALCRHVCRAVGESFVVRRGDHFLDGTRCVPSGPREDGALSLCVLGRCRTFGCDGRLD
SQQVWDVCQVCGGDNSTCSPQNGSFTAGRAGEYVTFLTVTPNLTRVYVANRRPLFTHLAV
RVRGRYVVAGNASLSPSTTHPSLLEDSRVEYRLTLTEDRLPQLEEVHIRGPAPGDIEIQV
YRRYGDEYGALTRPDITFSYFQPKQRPAWVWAAVHGPCSVSCGAGLRWVTYSCLDQAQNQ
WVETARCRGSLRPPAWPEPCIPEPCPPYWAAGDFGPCSVSCGGGLRVRLVRCVEEAPGGR
LRTLPPARCRVGAQQPAAVEPCSPQPCPSRGEVSGSGLALENVTCAQGADGLQVPVTAGP
CSTAEQLPTLEPCVGIACPPGWGLLDTKSLREEAPPPLGTASPGTRAAPVWTPVAGPCSV
SCGRGLMELRFWCVDAVLRTPVQEELCDSASKPRDQRGVCQAAPCPARWDARALGPCPVT
CGEARVPLAVRCVRPDGGRLVPLPHSKCWPAPQPDPFQDCSSEPCPPRWRYQLAACSVSC
GGGVVRRMLYCARARGEDEGDEEILTDAQCQGLPRPEPHEACGLEPCPPRWKVASLGPCS
ASCGLGTAVRSVACVQLDQGQDTVVDEAACAALVRPQARVPCLIADCPYRWQVSSWTECS
VSCGAGVQRRHDACLGPQAQAPMPADFCQHLPKPATVRGCWAGPCVGQGPASPAPHEEAT
APGQATAAGAGTALEWRQPRTRLPPPAPQPLGHLPGPQGKLGESSACGRQLLEPAGTIDL
RGARQGDCAVALGRPLGEVVTLHVLESSLNCSLGDMLVVWDRLTWRKTCRELSGATFVSL
SNTLVVQQRRAGPRGGVVLRHGSRPAPQPYRECDVQLFGPRGEIVSPSPSAHGGRAGGCR
LFISVAPQARIAIHALAAGTAPGTEGANASDITIRDSHSWSTTAFRGQQVLYWESRGSQA
EVEFSQSFLEAGASLRGHYWTF
NT seq 4389 nt   +upstreamnt  +downstreamnt
atgagccgggctcggccctgggcgggaggccggcggctccaggtggcccgcgtgaggggg
accctgaccggtgccctctttctcctgggctgtggggcgctcgccgatttccagcaggcg
ggcaccgtcctggtgggcggggaccgacgttacctccggccggagccactgcctcactgg
ggcggggccagggccccagagaccgtaccaggcccctcgaggagacggagactggttgcc
ggggacatcctgcacctggagctgctggtggccgtgggcgccgacatccaccaggctcac
caggaggacacggagcgctacgtgctcaccaacctcaacatcgcgtcggagctgctgagg
gacccgtccctgggggcgcggttctgggtgcacctggtggggatgctcatcctgacggag
ccgaagcaaggtccagaagtctcggccaacatcacctcctccctgctgagcgtgtgtgag
tggggccgcacagtcaaccccacagacgactcggaccccaggcacgccgacctggtcctc
tacgtcaccaggtttgacctggagctgcctgatggcaaccggcaggttcggggggtcacc
cagctggggggcgcctgctccccctcctggagctgtctgatcaccgaggacacgggcttc
gacttgggggtcaccatcgcccacgagatcgggcacagcttcggcctgcagcacgacggc
gccccgggcagcagctgtggccccagcggccacgtgatggcgtcggacggcgcggcgccc
gcccgcggggtcctgtcctggtccgcctgcagccgccggcagctgcagagcctgctcagc
gcaggaggggcgcgctgtgtgcgggacccgccaggggccgcgcctgtgaggcgcgcgccc
gaggggcagcccggcctctactacggcgccgaccagcagtgccgcgttgccttcggcccc
tcggcagccgcctgcaccttcgcccgagagcctctcgatgtgtgcgaggccctctcctgc
cacacggacccgctggaccggagcagctgcagccgactcctcgtccctctcctggacggg
acgccctgtggcgtggagaagtggtgctccaaggggcactgccgctccctggcggagctg
acccccgtggcggccgtgcacggccgctggtccagctggggccctcctagtccctgctca
cgctcctgcggagggggtgtggccaccaggaggcggcgctgcgacaaccccagacctgcc
ttcggggggcgcgtgtgcgagggagccgacctccaggcggagctgtgcaacacccaggcc
tgcgagaagacccagctggacttcatgtccgagcagtgcgcgcagaccgacagccagccc
ctgcgcctctctccagacagcgcctccttctaccactgggaggcggcggcgcggtacagc
cgaggagacgccctgtgcagacacgtgtgccgggccgtgggcgagagcttcgtggtgagg
cgtggagaccacttcctggatgggacccggtgtgtgccaagtggccctcgggaggacggg
gccctgagcctgtgtgtgctgggccgctgcaggacgtttggctgtgacggtcggctggac
tcccagcaggtgtgggacgtgtgccaggtgtgtggcggggacaacagcacgtgcagccca
cagaacggctccttcacggccggaagggccggagagtacgtcacctttctgacggtcacg
cccaacctgaccagggtgtacgtggcaaaccgcaggcctctcttcacacacctggcggtg
cgggtgcgcgggcgctacgtggtggccgggaacgcgagcctctcccccagcaccacccac
ccctccctgctggaggacagccgcgtggagtacaggctgacgctcaccgaggaccggctg
ccccagctcgaggaggtccacatccggggacccgccccgggggacatcgagatccaggtt
taccggcggtacggagacgagtacggcgccctcacccgccccgacatcaccttcagctac
ttccagcccaagcagcggccggcctgggtgtgggccgccgtgcatgggccgtgctccgtg
agctgtggggcagggctgcgctgggtgacctacagctgcctggaccaggcccagaaccag
tgggtggagactgcccggtgccgagggagcctccggccgcccgcgtggccggagccctgc
atccctgagccctgtcccccgtactgggcagccggggacttcggcccgtgcagcgtctcc
tgtggcggaggcctgcgggtgcggctggtgcgctgcgtggaggaggccccgggcgggcgc
ctgaggacgctgcccccggcccggtgcagagtgggggcccagcagccggcagcagtggag
ccctgcagcccccagccctgccccagcaggggagaggtgtcaggctccggcctggccttg
gagaacgtgacgtgtgcgcagggcgccgacggcctgcaggtgcccgtgaccgcagggccc
tgctccacggccgagcagctgcccaccctggagccctgtgtcgggattgcgtgtcctcca
ggctggggtctgcttgacaccaagtctctgagggaggaggctccgcccccactgggcact
gccagcccggggacccgagctgcgcctgtgtggactcctgtggccgggccgtgctccgtg
tcctgtgggcgaggcctcatggagttgcgtttctggtgcgtggacgccgtcctcaggacg
ccggtccaggaggagctgtgcgactcggcaagcaagcctagggaccaacgtggggtctgc
caggccgccccctgccctgcacggtgggacgcccgggccctgggcccgtgcccggtgacc
tgtggagaggcccgggtgccgctggcggtgcgctgcgtgaggcccgacggcgggcgcctt
gtgcccctgcctcactccaagtgctggccggcgccccagccggaccctttccaggactgc
agctcagagccctgccccccgaggtggcggtaccagctggcggcctgcagcgtgagctgt
gggggcggggttgtgcggaggatgctgtactgcgcccgggcccgcggggaggacgagggc
gacgaggagatcctaacggatgctcagtgccaggggctgcctcgcccagagccccacgag
gcctgcggcctggagccctgcccgcccaggtggaaagtcgcgtccctgggcccgtgctca
gccagctgtggcctcggcaccgccgtgcgctctgtggcctgcgtgcagcttgaccaaggc
caggacactgtggtggacgaggcggcctgtgccgctctggtgcggccccaggccagggtc
ccctgcctcatcgccgactgtccctaccggtggcaggtcagctcctggacagagtgctcc
gtctcctgcggggcgggcgtccagcgccggcatgacgcctgcctcggcccccaggcccag
gctcccatgcctgccgacttctgccagcacttgcccaagccagcgacggtgcggggctgc
tgggcagggccctgtgtggggcaggggccggccagccccgcaccccacgaggaagccacg
gctcccggccaggccacagccgctggagctggaactgcactggagtggcgccagccccgg
acccgcctcccgcccccggctccccagcctctggggcacctgcccggaccccagggaaag
ctgggggagtccagtgcctgcggccgacagctcctggagccggcaggaaccattgacctg
cgaggcgcccggcagggagactgtgcggtggccctcggacggcccctgggcgaggtggtg
accctccacgtgctggagagctccctgaactgcagccttggggacatgctggtggtctgg
gaccggctcacgtggaggaagacgtgcagggagctgtcgggcgcgactttcgtctccttg
agcaacaccctggtggtgcagcagcgccgtgcggggccgcggggcggagtggtgctgcgg
cacgggagccggcctgccccgcaaccctaccgagaatgtgacgtgcagctctttggaccc
cggggggagatcgtgagcccctcgcccagtgctcatggagggcgggcagggggctgccgg
ctcttcatcagcgtggccccgcaggcccgcatagccatccacgccctggccgccggcacg
gcccctggaaccgagggagccaacgccagcgacatcacgatccgggacagccacagctgg
agcaccacagccttccgtgggcagcaggtgctctactgggagtccaggggcagccaggcc
gaggtggagttcagccagagctttttggaggccggcgccagtctgcgaggccactactgg
accttctga

DBGET integrated database retrieval system