KEGG   Oryctolagus cuniculus (rabbit): 100344635Help
Entry
100344635         CDS       T03373                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00071  Fatty acid degradation
ocu01212  Fatty acid metabolism
ocu03320  PPAR signaling pathway
ocu04152  AMPK signaling pathway
ocu04714  Thermogenesis
ocu04920  Adipocytokine signaling pathway
ocu04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100344635
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100344635
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100344635
   04920 Adipocytokine signaling pathway
    100344635
   03320 PPAR signaling pathway
    100344635
  09159 Environmental adaptation
   04714 Thermogenesis
    100344635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100344635
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100344635
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100344635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 100344635
NCBI-ProteinID: XP_002724095
Position
Un
AA seq 324 aa AA seqDB search
MWEFTLATECFQLGYSADGHCKGRPDPALPPPQRLQWDLPDQIHPSISLALSGARTLSGN
IDCHVFPFSHFGKSFIRRCHLSSDSFIQMALQLAHFRDRGQFCLTYESAMTRLFLEGRTE
TVRCCTREACNFVRAMEDKEKTDPQCLALFRTAVDKHQALLKAAMTGQGADRHLFALYIV
SRFLHLQSPFLAQVHSEQWHLSTSQVPVQQMHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YIFMGDDRITFHISSRKSSTKTDSHRLGQHIENALLDVASLFQAGRSPKRRFRGSGEMDS
GPRCGILSSQIVDDSKLPTAPSSL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtgggagttcacgctggccaccgagtgcttccagctgggctactctgcggacggccac
tgcaagggccgccccgaccccgcgctgcccccgccccagcggctgcagtgggaccttcca
gaccagatccacccgtccatctctctggcgctgagtggagccaggacgctgtctgggaac
attgactgccacgtcttccccttctcgcacttcggcaagagcttcatccggcgctgccat
ctctcttccgacagcttcatccagatggccttgcagctggcccacttccgggacaggggt
cagttctgtctgacttacgagtctgccatgactcgcttgttcctggaaggccggacggag
acggtgcggtgttgcacgagggaggcctgtaacttcgtgagagccatggaggacaaggag
aagacggacccgcagtgcctcgccctgttccgcaccgcggtggacaagcaccaggcgctg
ctgaaggcggccatgaccgggcagggggccgaccgccacctcttcgcgctctacatcgtc
tcacgattcctgcacctgcagtctcccttcctggcccaggttcactcggagcagtggcac
ctgtccaccagccaggtccctgtgcagcaaatgcacctgtttgacgttcacaattacccc
gactacgtttcctccggaggtggattcgggcctgccgatgaccacggctacggggtttcc
tacatcttcatgggggacgacaggatcaccttccacatctccagcaggaaatcaagcaca
aaaacggactcccaccggctggggcagcacatcgagaatgccttgttggacgtggcctcc
ctgttccaggcagggcggagtccaaagcgccggttccgaggttcgggggagatggactca
gggcccaggtgtggcatcctctccagccagatcgtggacgactccaagctacccacggca
cccagcagcctctga

DBGET integrated database retrieval system