KEGG   Oryctolagus cuniculus (rabbit): 100344710Help
Entry
100344710         CDS       T03373                                 

Gene name
CCDC149
Definition
(RefSeq) coiled-coil domain containing 149
Organism
ocu  Oryctolagus cuniculus (rabbit)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2353 CALCOCO1 Csm1_N TSC22 APG6_N Occludin_ELL CENP-F_leu_zip HAP1_N Spc7 TPR_MLP1_2 FapA THP2 DivIVA
Motif
Other DBs
NCBI-GeneID: 100344710
NCBI-ProteinID: XP_008272883
Ensembl: ENSOCUG00000007463
UniProt: G1U7G1
Position
2
AA seq 527 aa AA seqDB search
MNGDRTESDWQGLVSEYLVCKRKLESKKEALLILSKELDSCQQERDQYKLMANQLRERHQ
SLKKKYRELIDGDPSLPPEKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKL
LRMTIAKQRLGDEEIGVRHFAAHEREDLVQQLEQAKEQIEALEHDLQASVDELQDVKEER
CSYQDKVERLNQELNHILGGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYK
NALERRKNSKGQGKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSVSDLKSLATALLE
TVHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGLSYNVSIGFGRGKDTIL
FGDPTLPTRQRARSPLLKFEPPAQSKANAKDGEAPKLEGDGSRAAAAQVVPAPEDAGGPA
VHSPAHPSPGNQHEHLQSASPMAPSEQNEDDRLGRESLRLTPGQLAPGADGSGRERPHVE
GQGSEVGPATPGATSHGEPLKSRLDAPESTQAPALGDGAGVPGARGT
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgaccgcaccgagagcgactggcaggggctggtgagcgagtacctggtgtgt
aaaaggaagctggagagtaagaaggaagcactcctgatcctttctaaggagctggacagc
tgccagcaggaacgggaccagtacaaactcatggccaaccagcttcgggagcgccaccag
tcgctgaagaaaaagtaccgagaactgatcgatggagatccatcactaccacctgagaag
agaaagcaggctaacctggcacaactgttgcgagattcgcaggaccgaaataaacacctg
ggagaagagattaaagaacttcagcaaaggctcggcgaagtgcaaggtgacaataagctc
ttgaggatgaccattgccaaacagaggctgggggatgaggagatcggcgttcggcacttt
gcagcccacgagcgcgaagacttggtgcagcagctggagcaggctaaggagcagatcgaa
gctctggagcacgacctgcaggcctctgtggatgagcttcaggacgtgaaggaggagcgc
tgttcctaccaggacaaggtggagaggctgaaccaggagctcaaccacatcctgggtggc
cacgagaaccgcatcatcgacgtggacgccctgtgcatggagaacaggtatcttcaagag
aggttaaaacaactccacgaagaggtcaaccttttgaaatcgaacattgccaaatacaag
aatgctctcgagaggcggaagaactcgaagggccaggggaagtcgagcagcagcgctctg
actggagtcctgtctgcaaagcaagttcaggatttgctctcggaagatcacgggtgcagt
ctcccagcgacgccgcagtccgtttccgacctgaagtctctggccacggccctgctggag
accgtccacgagaagaacatggtcattcagcatcagaggcagaccaacaaaatcctaggg
aatcgggtggctgagttggagaaaaaattaagaaccctggaagtttctggtttgtggagt
ctcccaggcctgagctacaatgtgtccataggattcgggaggggcaaggacaccatactg
tttggtgaccctactcttcccaccagacagagggcgagatccccgctgctgaagtttgag
ccgcccgcccagagcaaggccaacgccaaggacggggaggctccgaagctggaaggagat
ggaagccgtgcagctgctgcccaggtggtgccagcccctgaggatgccgggggtcctgct
gtccactcccccgcacacccgagccccgggaaccagcacgagcaccttcagtctgcctcg
cccatggcgccttctgagcagaacgaagacgacaggctggggagggagagcctgagactg
acacccggacagctggccccgggagcggacgggagcggaagagagcgcccccatgtggag
gggcagggcagcgaggtgggcccggccacccccggcgccaccagccacggggagcccctg
aagtctcgcctggacgccccggagtccacccaagctcctgcgctgggagatggcgcaggg
gtcccaggggccagaggcacgtga

DBGET integrated database retrieval system