KEGG   Oryctolagus cuniculus (rabbit): 100345122Help
Entry
100345122         CDS       T03373                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04136  Autophagy - other
ocu04140  Autophagy - animal
ocu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100345122 (ATG16L1)
   04136 Autophagy - other
    100345122 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100345122 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100345122 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100345122 (ATG16L1)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    100345122 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    100345122 (ATG16L1)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100345122 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Ge1_WD40 KASH_CCD DUF2332 Fez1
Motif
Other DBs
NCBI-GeneID: 100345122
NCBI-ProteinID: XP_002721481
Ensembl: ENSOCUG00000015285
Position
Un
AA seq 607 aa AA seqDB search
MSSGLRPGDFPRWKRHISEELRRRDRLQRQTFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDPPNRHELSPGHDSAWNDSQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQQK
DREMQVNEAKIAECLQTISDLETECLDLRTKLQDLEIANQTLKDEYDALQITFTALEEKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVLVDEASDHTEETSPVRAVSRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQEHVDA
HPGSGKEVRVPTTALCVFDAHDGEVNAVQFSPGSRLLATGGMDRKVKLWEAFGDKCEFKG
SLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSET
IVREMELLGKITALDLNPERTELLSCSRDDLLKVVDLRANAVRQTFSAPGFKCGSDWTRV
VFSPDGSYVTAGSADGSLYVWSVLTGKVEQVLTKQHSSCINAVAWSPSGLHVVSVDKGSK
AVLWAQP
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgggtctccgccccggcgacttcccccgctggaagcgccacatctcggaggag
ctgaggcgccgggaccggctgcagaggcagacgttcgaggagatcatcctgcagtacaac
aagttgctggaaaagtcggatcttcattcagtgttggcccagaaactacaagctgaaaag
catgacccaccaaaccggcatgagctaagtcctggacatgatagtgcatggaatgacagc
cagctgcaagaaatggcccagctgagaattaaacaccaagaagagctgactgaattacac
aagaaacgtggggagttagctcagctggtgatcgacctgaataaccagatgcagcagaag
gaccgggagatgcaggtgaatgaggcaaaaattgcagaatgcttgcagactatctctgac
ctggagaccgagtgcctggatctgcggactaagcttcaggacctggaaatagccaatcag
accctgaaggatgaatatgatgccctgcagatcacgttcactgccttggaggagaaactg
aggaaaaccacggaggagaaccaggagctggtcacccggtggatggctgagaaagcccag
gaagccaatcgcctcaacgcagagaatgagaaggactccaggcggcggcaagcccggctg
cagaaggagctcgcggaagccgcaaaggagcctctgccggtggagcaggacgatgacatt
gaagtcctcgtggatgaagcctctgaccacactgaggagacctctcccgtgcgagctgtc
agcagagcagccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttgggagacgctcagtctcttccttcccagtcccccaggaacatgtggatgct
cacccgggttctggtaaagaagtgagggtgccaaccactgccctgtgtgtctttgatgcc
catgatggggaagtcaacgctgtgcagttcagtccaggttcccgcttactggccacagga
ggcatggaccggaaagtaaagctttgggaagcgtttggagacaaatgtgagtttaagggt
tccctgtctggcagtaatgctggcatcaccagcattgaattcgacagtgctggttcttac
ctcttagcagcttccaatgattttgcaagccgaatctggactgtggatgattatcgatta
cggcacacactcacgggacacagtgggaaagtgctctctgccaagttcctgctggacaac
gcacggatcgtgtcgggaagtcacgaccggaccctcaaactctgggacctgcgcagcaaa
gtctgcataaagacagtgtttgcaggatccagttgcaatgatattgtctgcacagagcag
tgtgtaatgagtggacattttgacaagaaaattcgtttctgggacatccgatcagagacg
atcgtccgagagatggagctgttggggaagattactgccctggacttgaacccagaaagg
accgagctcctgagctgctcccgtgacgacctgctcaaagttgttgatctccgagcgaat
gctgtgaggcagacattcagtgcgcctggattcaagtgcggctctgactggaccagagtt
gtcttcagccccgatggcagttacgtgacagcaggctcggccgacggctcgctctacgtg
tggagtgtgctcacggggaaagtggagcaggtgctaacgaagcagcacagctcatgcatc
aatgcggtggcatggtccccctccggcctccacgtggtcagtgtggacaaaggcagcaaa
gccgtgctgtgggcacagccgtga

DBGET integrated database retrieval system