KEGG   Oryctolagus cuniculus (rabbit): 100345556Help
Entry
100345556         CDS       T03373                                 

Gene name
SYK
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04380  Osteoclast differentiation
ocu04611  Platelet activation
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu05152  Tuberculosis
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100345556 (SYK)
   04072 Phospholipase D signaling pathway
    100345556 (SYK)
   04151 PI3K-Akt signaling pathway
    100345556 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100345556 (SYK)
   04625 C-type lectin receptor signaling pathway
    100345556 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    100345556 (SYK)
   04662 B cell receptor signaling pathway
    100345556 (SYK)
   04664 Fc epsilon RI signaling pathway
    100345556 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    100345556 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100345556 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100345556 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100345556 (SYK)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100345556 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100345556 (SYK)
   05169 Epstein-Barr virus infection
    100345556 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100345556 (SYK)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100345556 (SYK)
Protein kinases [BR:ocu01001]
 Non-receptor tyrosine kinases
  SYK family
   100345556 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase RIO1
Motif
Other DBs
NCBI-GeneID: 100345556
NCBI-ProteinID: XP_002708308
Ensembl: ENSOCUG00000017539
UniProt: G1TDW9
Position
1
AA seq 628 aa AA seqDB search
MASNTVDSANHLPFFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHGRKA
HHYTIERELNGTYAIAGGRTHSSPAELCHYHSQESDGLICLLKTPFNRPPGVQPKTGPFE
DLKESLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGKISRDESEQT
VLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRINKDKTGKLSIPEGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGTQMGNVNFDARPQLPSSHPAAWSAGGIISRIKSYSFPK
PGSKKPPPPQGSRPDSSISYNPYEPDRGPQREAMPMDTEVYESPYADPEEIRPKEVYLDR
KLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLSEANVMQQL
DNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEE
CNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYY
KFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPPGCPREMYELMNL
CWTYEVEKRPGFVAVELRLRNYYYDVVN
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacacggtggacagtgccaaccacctgcccttcttcttcggcaacatcacc
cgggaagaggccgaggattacctggtccagggaggcatgactgatgggctctacctgctg
cgccagagtcgcaattacctgggcggctttgccctgtcggtggcccacgggaggaaggcg
caccactacaccatcgagagggagctcaatgggacctatgccatcgctggtggcaggaca
cacagcagccccgccgagctctgtcactaccactctcaggagtccgacggcctcatctgc
ctcctcaagacgcccttcaaccggccccctggggtgcagcccaagaccgggccctttgag
gacttgaaggagagcctcatcagggagtacgtgaagcagacgtggaacctgcagggccag
gctctggagcaagccatcatcagtcagaagccgcagctggagaagctgatcgccaccacc
gcccacgaaaagatgccctggttccacgggaaaatctctcgggatgaatctgagcaaacc
gtcctgatcggatcgaagacgaacggaaaatttctgatcagggccagagacaacaacggc
tcctacgcgctgtgcctgctgcacgaggggaaggtgctgcactaccgcatcaacaaagac
aagaccgggaagctctccatcccagaggggaagaagttcgacacactctggcagctggtg
gagcattattcttacaaacccgatggtttgttacgagtccttacggttccatgtcaaaaa
attggcacgcagatgggaaatgttaattttgatgctcgcccacaacttccaagctcccat
cctgcggcgtggtcggcgggtggaataatctccagaatcaaatcttactccttcccaaag
cctggctccaaaaagccacccccgccccaagggagccggccggacagcagcatctcgtac
aacccctacgagccagacagaggcccccagagggaagccatgcccatggacacagaagtg
tacgagagcccctatgctgaccccgaggagatcaggcccaaagaggtctacttggaccgg
aagctgctgaccctggaagacaaagaactgggctccggcaacttcgggaccgtgaagaag
ggctactaccaaatgaagaaggtggtgaagacggtggctgtgaaaatactaaagaacgag
gccaacgacccggccctgaaagacgagctgctgtcggaagccaacgtcatgcagcagctg
gacaacccctacatcgtgcgcatgatcgggatctgcgaagccgagtcgtggatgctggtg
atggagatggcggagctcgggcctctcaataagtacttgcagcagaacaggcatgtcaag
gacaagaacatcatagagctggttcatcaggtttccatggggatgaaatacttggaggag
tgcaattttgtgcacagagatctggctgcaaggaatgtactgctggtcactcaacattac
gccaagatcagcgactttggactttccaaagctctgcgtgcagacgagaactactacaag
gcgcagacgcacgggaagtggcccgtgaagtggtacgcgcccgagtgcatcaactactac
aagttctccagcaagagcgacgtgtggagcttcggcgtgctgatgtgggaggccttttcc
tacgggcagaagccgtaccgggggatgaaaggcagcgaagtcaccgccatgctggagaaa
ggagagcggatggggtgccctccagggtgcccgagagagatgtacgagctgatgaacctg
tgctggacgtacgaggtggagaagaggcccgggtttgtagcggtggaactgcggctgcgc
aattactactacgacgtggtgaactaa

DBGET integrated database retrieval system