KEGG   Oryctolagus cuniculus (rabbit): 100346443
Entry
100346443         CDS       T03373                                 

Gene name
RDH5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100346443 (RDH5)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     100346443 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 100346443
NCBI-ProteinID: XP_002711103
Ensembl: ENSOCUG00000025839
UniProt: G1TWV2
Position
4
AA seq 318 aa
MWLLLLLGALLWAGLWLLRDRQSLPSSDAFIFITGCDSGFGRLLALRLDQKGFRVLAGCL
TPSGAENLQQVASSRLHTTLLDVTDPQSVQRAATWVESHVKEAGLFGLVNNAGVAGIIGP
TPWLTRDDFHRVLSVNTLGPIGVTLALLPLLQQARGRVVNVSSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVQVSIVEPGFFRTPVTNLESLDSGLQACWARLPPATQAQYGET
FLTKYLTVQRRIMNLICDPDLTKVSKCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPQPAQTVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgctcctgctgctgggtgccttgctctgggcagggctgtggctgctcagggac
cggcagagcctgcccagcagcgatgccttcatcttcatcaccggctgtgactcaggattc
gggcgccttctggcactgcgactggaccagaagggcttccgggtcctggccggctgcctc
actccctctggggcagagaacctacagcaggtggcctcctcccgcctccacaccacgctg
ctggacgtcactgacccccagagtgtgcagcgggcagccacgtgggtggagtcacacgtt
aaggaagcagggctctttgggctggtgaataacgctggcgtggccgggatcatcgggccc
acaccgtggctgacacgagacgacttccaccgcgtgctgagtgtgaacacgttgggtccc
atcggggtcactcttgccctgctgcccctgctgcagcaggcccggggccgggtagtgaac
gtcagcagcgtcctgggccgcctggcagccaacggtgggggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggacgtggctccttttggggtccaagtc
tccatcgtggagcctggcttcttccgaacccctgtgaccaacctggagagcctggacagc
ggcctgcaggcctgctgggcacggctgcccccagccacacaggcccagtacggggagacc
ttcctcaccaagtatctgacagtgcagcgacgcatcatgaacctgatctgtgacccggac
ctcaccaaggtgagcaagtgcctggagcacgccctgactgctcgtcaccctcgaacccgc
tacagcccaggctgggacgccaagctgctctggctgccggcctcctacctgccggccagc
ctggtggatgccgtgctcacctgggtccttccacagcctgcccagaccgtctactga

DBGET integrated database retrieval system