KEGG   Oryctolagus cuniculus (rabbit): 100346742
Entry
100346742         CDS       T03373                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu01100  Metabolic pathways
ocu01522  Endocrine resistance
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04114  Oocyte meiosis
ocu04211  Longevity regulating pathway
ocu04213  Longevity regulating pathway - multiple species
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04270  Vascular smooth muscle contraction
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04727  GABAergic synapse
ocu04742  Taste transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04913  Ovarian steroidogenesis
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04970  Salivary secretion
ocu04971  Gastric acid secretion
ocu04972  Pancreatic secretion
ocu04976  Bile secretion
ocu05032  Morphine addiction
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100346742 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100346742 (ADCY4)
   04371 Apelin signaling pathway
    100346742 (ADCY4)
   04020 Calcium signaling pathway
    100346742 (ADCY4)
   04072 Phospholipase D signaling pathway
    100346742 (ADCY4)
   04024 cAMP signaling pathway
    100346742 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100346742 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100346742 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100346742 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100346742 (ADCY4)
   04062 Chemokine signaling pathway
    100346742 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100346742 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100346742 (ADCY4)
   04912 GnRH signaling pathway
    100346742 (ADCY4)
   04913 Ovarian steroidogenesis
    100346742 (ADCY4)
   04915 Estrogen signaling pathway
    100346742 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100346742 (ADCY4)
   04921 Oxytocin signaling pathway
    100346742 (ADCY4)
   04926 Relaxin signaling pathway
    100346742 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100346742 (ADCY4)
   04918 Thyroid hormone synthesis
    100346742 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100346742 (ADCY4)
   04916 Melanogenesis
    100346742 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100346742 (ADCY4)
   04927 Cortisol synthesis and secretion
    100346742 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100346742 (ADCY4)
   04270 Vascular smooth muscle contraction
    100346742 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100346742 (ADCY4)
   04971 Gastric acid secretion
    100346742 (ADCY4)
   04972 Pancreatic secretion
    100346742 (ADCY4)
   04976 Bile secretion
    100346742 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100346742 (ADCY4)
   04727 GABAergic synapse
    100346742 (ADCY4)
   04725 Cholinergic synapse
    100346742 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100346742 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100346742 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100346742 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100346742 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100346742 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100346742 (ADCY4)
   04714 Thermogenesis
    100346742 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100346742 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100346742 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100346742 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100346742 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100346742 (ADCY4)
   05163 Human cytomegalovirus infection
    100346742 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100346742 (ADCY4)
Enzymes [BR:ocu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100346742 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 100346742
NCBI-ProteinID: XP_008267668
Ensembl: ENSOCUG00000002958
Position
17
AA seq 1086 aa
MARLFSPRPPPSDDLFYETYYSLSQQYPLLLLLLGIVLCALVALLGVAWASGRELISDPS
FLSTVLCALGGFSLLLGLASREQRLQRWTRALSGLVWAALLALGHGFLFTGGVVSAWNQV
SFFLFVIFTAYAMLPLGMRDAVAAGLASSLSHLLVLGLYLGPQPDSQPALLPQLAANAVL
FVCGNAVGAYHKALMERALRATFREALSSLQSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPVSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGHELLRPSLLMT
RYLESWGAAKPFAHLSHIDSPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDA
KFFQVIEQLNSQKQWRQSKDFSPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFLSNF
IIQMLVTDRPPALAITYSITFLLFFLLLFVCFSEHLTKCVLKGPKMLHWLPTLSGLVATR
PGLRVALGTATILLVFIMAITSLFFLPASLDCPPWAPNVSSIAFNLSWQLPGSLPLLSVP
YSMHCCVLGSLSCSLFLHMSFELKLLLLLLWLVASCSLFLHSHAWLSDCLIARLYVGPLD
SRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETEMMENLTR
LLLENVLPAHVAPQFIGQKRRNEDLYHQSYECVCVLFASIPDFKEFYSESNINHEGLECL
RLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQVQQQAHCQDAER
SCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTV
NVASRMESTGVLGKIQVTEETAQALQSLGYTCCIRGIIKVKGKGQLRTYFLNTDLTRTGP
PSATLG
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggcgcgcctcttcagcccccggccgcctcccagcgacgacctcttttacgagacctac
tacagcttgagccaacagtacccgctactgctgctgctgctggggatcgtgctgtgcgcg
ctcgtggcgctgctcggcgtcgcctgggccagcggcagggagctgatctcagacccgagc
ttcctaagcaccgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctggcttcc
cgcgagcagcgacttcagcgctggacgcgcgccctgtccggcctcgtgtgggccgcgctg
ctagcgctcggccacggcttcctgttcacagggggcgtggtgagcgcctggaaccaggtg
tcctttttcctcttcgtcatcttcacggcgtatgccatgctgcccttggggatgcgggac
gcggtcgctgcaggcctggcctcttcactctcgcacctgctggtcctggggctgtacctt
gggccacagcctgattcgcagccggcgctgctgccgcagcttgcagccaacgcagtgctg
ttcgtgtgtgggaacgcggtgggggcgtaccacaaagcgctgatggagcgtgccctgcgc
gccaccttccgcgaggcgctcagctccctgcagtcgcgccggcggctggacaccgagaag
aagcaccaggaacacctgctgttgtccatccttcctgcctacctggccagggagatgaag
gcagagatcatggctcggctgcaggctggacaggggtcccggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcaccaggctggccagcgagtgctcccccaaggagctggtgctcatgctcaacgag
ctctttggaaaattcgaccagatcgccaaggagcacgaatgcatgcggatcaagatccta
ggggactgctactactgtgtctccgggcttccagtctccctgccagaccatgccatcaac
tgcgtacgcatggggctggacatgtgccgggccatcaggaaactgcgggcagccactggt
gtagatatcaacatgcgtgtgggcgtgcactcgggcagcgtgctctgcggagtcatcggc
ctgcagaagtggcagtacgatgtctggtcccatgacgtcacactggccaaccacatggag
gcaggcggcgtgccaggacgagtgcacatcacgggggccacgctggctctgctggccggg
gcttacgcagtggaggacgcagccatggaacaccgggacccgtaccttcgagagctaggg
gagccgacctacctggtcattgatccccgggccgaggaggaggacgagaagggcacagca
ggagggctgctgtcctctctcgagggccacgagctgctgcgtccgtctctgctgatgacc
cgctacctggagtcgtggggtgcagccaagccttttgcccacctgagccacatagacagc
cctgtgtccacctccacccctctcccggagaaggccttggcttccttcagcccccagtgg
agcctggaccggagccgtaccccccggggcctagacgatgagctggacaccggggatgcc
aagtttttccaggtcatcgaacagctcaactctcagaaacaatggaggcagtcgaaggac
ttcagcccactgacgctctacttcagagagaaggagatggagaaggagtaccgtctctcc
gcactccctgccttcaagtactatgcagcctgcaccttcctggtttttctctccaacttc
atcatccagatgctggtgacagacaggcccccagctctggccatcacctacagcatcacc
ttcctcctcttcttcctcctgctcttcgtctgcttctcagagcacctgacgaagtgtgtc
ctgaagggccccaagatgctgcactggctgcccacactgtccggcctggtagccacacgc
cctggactgcgagtggccctgggcactgccaccatcctcctcgtcttcatcatggccatt
accagcctgttcttcctaccagcatcgctggactgtccaccctgggctcccaatgtgtcc
tccattgctttcaacctctcctggcagctccctgggtccctgcccctcctcagtgtccca
tactccatgcactgctgcgtgctgggctccctgtcctgctccctctttctgcacatgagc
ttcgaactcaagctgctgctgctgctgctctggctcgtggcctcctgctccctcttcctg
cactcccacgcctggctgtccgactgcctcatcgcccgcctctacgtgggacccttggac
tccaggccgggcgtgctgaaggagcccaagctgatgggagccatctccttcttcatcttc
ttcttcaccctccttgtcctggctcgacagaatgagtattactgccgcctggacttcctg
tggaagaagaagctgaggcaagagcgcgaggagacagagatgatggagaatctgacccgg
ctgctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaacgg
cgcaacgaggacctctaccaccagtcctacgagtgtgtttgtgtcctcttcgcctccatc
ccagactttaaggagttctactcggaatccaacatcaaccacgaagggctcgagtgtttg
cggctactcaatgagatcattgctgatttcgatgagctgctctccaagcccaagttcagc
ggggtggagaagatcaaaaccatcggcagcacctacatggcagccacaggcttaaacgcc
acctctggccaggatgcccaacaggtccagcaacaggcccactgccaggatgctgagcga
agctgcagccaccttggcaccatggtggaatttgcagtggccctggggtccaagctagac
gtcatcaacaagcactcgttcaacaacttccgcctgcgtgtggggctgaaccacggacca
gtagtggctggagtcattggggcccagaagccacaatatgacatctggggcaacacggtg
aatgtggccagccgcatggagagcaccggagtcctgggcaaaatccaggtgactgaggag
acagcccaggccctgcagtcgctgggctacacctgctgcattcggggcatcatcaaggtc
aaaggcaaagggcagctgcgcacctacttcctgaacacggacttgacgcgaactgggcct
ccctcagccaccctgggctga

DBGET integrated database retrieval system