KEGG   Oryctolagus cuniculus (rabbit): 100347526
Entry
100347526         CDS       T03373                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100347526 (AKAP5)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     100347526 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 100347526
NCBI-ProteinID: XP_008270107
Ensembl: ENSOCUG00000011733
UniProt: G1TYZ6
Position
20
AA seq 403 aa
METSVSEIQVENKEEGRSAEASPQGERPGDQAATLCFKRRKKAAPAPKQKPKPAVGSEGP
AAARPGPGPAGAGASHQPPRRAGAWASLQRLVTRRKRADSAQAQRREEAEARSDVRAEDA
TLPKKRPRSRLKIPCVKFSRGGKKGARSQILEDSDCSGRVQGEAEGSTTRARTPSAERAA
KAAQAPAPPEASEAPGRGRGPSGEQVIAVELGSDGGRPAVQTGALVLGKDSDTAAQEEEE
EPGVQAQPAGALEAAGTEPRSEAEAEDGVPESRPDREDSEREVAVAETEPEDSGLRQESD
WKENGVPAEKPQAEESKRMEPIAIIITDTEISEFDVKRSKNVPKPFLVSVDNDGGVEGRT
SEQYETLLIETASSLVKNAIQLSIEQLVNEMAADDNRINSPLQ
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggagacctcggtctccgaaattcaggtcgagaacaaggaggaggggcgctcggcggaa
gccagccctcagggtgagaggccgggggaccaggcggccacgctgtgcttcaagcgaagg
aagaaagcagccccggcgccgaagcaaaagccgaagccagcggtgggttctgagggccca
gccgccgccaggcccggccctggccctgcgggcgctggagcttcccatcagcccccgcgg
cgcgcaggcgcctgggcctccctccagcgcctcgtgacgcgccggaagcgggcggattcc
gcgcaggcgcagaggcgtgaggaggcggaagcgcggtccgacgtccgagccgaggacgcc
accctgcccaagaagaggccaagatccagactgaagattccttgcgtgaaattctcaaga
gggggcaagaagggcgcgcgttcccagattctcgaggactccgactgcagtggcagagtc
cagggagaggcggaagggtcgactacccgggcccggaccccgtcggccgagcgggcagcc
aaggccgcgcaggccccggcgcccccagaggcctctgaggcccctggccgcggccgcggg
ccttccggggagcaagtgatcgccgtggagctgggttccgatggcgggcggcctgctgtg
cagacaggagcgctcgtccttgggaaagacagcgacacggcggcgcaggaggaggaggag
gaaccgggagttcaagcccagccagccggtgcgctcgaggctgcaggtacagagcctcgc
agtgaggcagaagccgaggacggcgtccccgagagccggccggatcgggaagactcggag
agagaggtggccgtggcggagactgagccggaagactctggattgcgccaggaatcagac
tggaaagaaaatggcgtccctgcagagaaaccccaagcagaggagagcaaaaggatggag
cccattgccattattatcacagacaccgaaatcagtgaattcgatgtgaagaggtcgaaa
aatgtccccaagccgttcttagtttcagtggacaatgatggtggtgtggaggggagaact
tcagaacagtatgagacgctcttgatagaaacagcgtcttcgctcgtcaagaatgccatc
cagttgtctatagaacagctggtcaatgaaatggccgctgatgacaacagaataaacagc
cccctgcagtga

DBGET integrated database retrieval system