KEGG   Oryctolagus cuniculus (rabbit): 100347557
Entry
100347557         CDS       T03373                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    100347557 (AFF3)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100347557 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 100347557
NCBI-ProteinID: XP_008251601
Ensembl: ENSOCUG00000009532
Position
2
AA seq 1282 aa
MDSFDLALLQEWDLESLWGEDILNQRSDSLVVEFQSSASRCRSVYEPDRNALRRKERERR
NQETQQDVSTFASSYSLFSEPYKTNKGDELSNRIQNTLGNYDEMKDFLTDRSNQSHLVGV
PKPGVPQTPVNKIHEHFVADSRAQTQPSSVCSTTSATPAAVPVPQSKRSTMGWQKTGHPP
PPDGHQRTTQQGSLRTLLGDGVGRQQPRTKQVCNVEVGLQTQERPPAMATKHSSGGHCVQ
NFPSSLASKPSLLQQKPTAYVRPMDGQDQAPDESPKLKSSTETGVHCTSYRGVPATKPES
ARAKAKLSKFSIPKQAEESRAGESNSCVEEIIREMTWLPPLSAIQAPGKVEPSKFPFPNK
DSQLLSSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTGLRALSD
SAVVQQSNCGASVPSSQGSSSGSSSGSSSSSSDSESSSGSDSETESSSSESEGSKAPHYS
SPEAEPASSNKWQLDKWLNKVNPHKPPVLVQNENHGPDSSQYYTPVKEEAQDCGKLPDVC
PASLREKESKSVCKEEQRPRTANKAPGNKAVKQKSPPAAVAVTAAAAAPPPAVPGAPVDS
APAPTRRSAGKKPTRRTERTSAGDSANCHRPEEPVATDTLGASVAVAPEPTKARPCGNGR
TSHRKELRPSVPCEKRRTRGLSRTVPKSKEFIETESSSSSSSSDSDLESEQEEYPLTKAQ
TVAAAAATAAAATAAAASSSSSSSSSSASSSSSSSSSCASDQRLKEATSSISTGGGPRAP
AGPINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHL
PQEPGVLNGPAAKDPESALPALDTPPEKTLPKSKRKRKLDNDDDYREPKKVQGERETSSR
LSASANTALSANHCNMNITSLAIPINKNEKLLRPPISPVSDTSKHKYPSEDLPSSGRPHG
NSVLTSASSNKKPKGDGQLQSHAADLTKAAHSSENILLHGKTRPQTEPWSPGSNGHRDCK
RQKLVFDDMPRSADYFMQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPME
SKSPYTMYSETVELIRYAMRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAV
KYSKALIDYFKNSSKAAQAPSPWSTSGKSTGTPSPMSPNPSPTSSVGSQGSLSSASSLSP
TTIISIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSS
MEHLVQYSQQGLHWLRNSTHLS
NT seq 3849 nt   +upstreamnt  +downstreamnt
atggacagcttcgacttagccctgcttcaggaatgggacctcgagtcgctgtggggcgaa
gacatcttaaaccagaggagtgactctctagttgtggaattccagtcctcggccagcaga
tgcaggagcgtgtatgaacctgatagaaatgccctacggaggaaagaacgggagagaaga
aaccaggagacgcagcaggatgtcagcacgttcgcgtccagttactctctgttcagtgag
ccctacaagactaacaagggggatgagctctccaaccggatccagaatactttaggcaat
tatgacgagatgaaagattttttaactgatcgctccaaccagagtcatcttgttggcgtc
cccaaacccggggttccgcagacccccgtgaacaagatccatgagcattttgttgccgac
tcaagagcccagacccagccctcatcggtctgcagcaccacctctgccacaccagcggct
gtgcctgtgccacagagtaagaggagcaccatgggctggcagaagacggggcacccgcca
ccgcccgacggccatcagaggacaacacaacagggctctctcaggacactgcttggagat
ggcgttggcagacagcagccacggaccaaacaagtgtgcaatgtcgaggtggggcttcag
acccaggagaggccgcccgctatggccaccaagcacagcagtggcggccactgcgttcag
aactttccctcgtctctggcttcgaagcctagcctgctgcagcagaaaccgaccgcgtat
gtgcgcccaatggacggccaagatcaggctcctgatgagtctcccaagcttaagtcctct
acggaaaccggcgtgcactgcacatcgtacaggggagtccccgccaccaagccagagtcg
gccagagccaaggccaagctttccaagttcagcatccccaagcaagcagaggagagtaga
gctggagaaagcaacagctgtgttgaagaaataattcgggagatgacctggcttccacca
ctttctgctattcaagcacctggcaaagtggaaccaagcaaatttccatttccaaataag
gactctcagcttttatcctccggacacaataatccaaagaaaggtgacgcggagccagag
agtccagacaatggcacgtccaacacctcaatgttagaagatgacctgaagctaagtagt
gatgaagaagagaatgagcagcaggcagcccagagaacgggtctccgcgctctatctgac
agcgccgtggtccagcagagcaactgtggagcctccgtgccttccagccagggcagcagc
agcggtagcagcagcggcagcagcagctcctccagtgactcggagagcagctccggatcc
gactcggagaccgagagcagttccagcgagagcgagggcagcaaggcaccccactactcc
agccccgaggccgagccggcgtcctcgaacaagtggcagttggataagtggctcaacaaa
gttaatccccacaagcctcccgtcctggtccaaaatgaaaaccacgggcccgatagcagt
cagtactacaccccggtgaaagaggaggcgcaggactgcgggaagctccccgacgtgtgc
ccagctagcctgagggagaaggagagcaagagcgtctgcaaggaggaacagaggccgagg
acagccaacaaggcccctgggaacaaggcagtgaagcagaagtcccctcccgcggccgtg
gccgtgaccgcggccgcagccgccccgccgcctgcagtgcctggcgcaccggtggacagc
gcgcctgcgcccacgcgcaggtccgcgggcaagaagcccaccagacgcacggagaggacc
tcagccggggacagtgccaactgccaccgccctgaggagcccgtggctacagacacgctg
ggggcgagcgtggccgtggcccccgagcccaccaaagccaggccctgcggcaacggccga
acaagccaccgcaaggagctgcgcccctcggtgccctgcgagaagaggcgcacccggggg
ctgagcaggaccgtccccaaatccaaggagttcatcgagactgagtcgtcctcctcatcc
tcctcctccgactcggacctggagtcggaacaggaggagtaccctctgaccaaagcgcag
accgtggctgctgccgccgccactgccgctgccgccaccgccgccgccgcctcctcttcc
tcctcctcctcctcctcttccgcttcctcctcctcctcctcctcttcctcctgtgccagc
gaccagaggctaaaggaagctaccagcagcatcagcactgggggcggaccccgggccccc
gcaggccccatcaacgccaggaccaccagtgacattgccaaggagctagaggagcagttc
tacacgctggtccccttcggccgcaacgaacttctgtcccccttgaaggacagcgatgag
gtcaggtctctctgggtgaaaattgacctgaccctcctgtccaggatcccggaacacctg
ccccaggagccaggggtcttgaacggccctgctgctaaggacccagagagcgcactgcca
gcattggacacgccgcccgaaaagactttgccaaaatccaagaggaaacgcaagcttgac
aacgacgacgactatcgggagccgaagaaagtccagggggagagagagacctcctcgcga
ttgagtgcctccgccaataccgctctgtccgcgaaccactgcaacatgaacatcaccagc
ttggcaataccaatcaacaaaaatgagaagctgctccggccgcccatctcccccgtctca
gacacgtcgaagcacaaataccccagcgaggacttgccctcctcaggccgcccgcacggc
aacagcgtgctcacctccgcctcttccaacaagaagcccaagggtgacgggcagctgcag
tcgcacgccgcggacctcacgaaagcagctcacagctccgaaaacattctcctccatggc
aagacacggccgcagacagagccttggtccccaggatccaatggccacagggactgcaag
agacagaagcttgtcttcgatgacatgcctcgcagtgccgattattttatgcaggaagct
aaacggatgaaacataaagcagatgcaatggtggagaagtttgggaaggccctgaactat
gccgaagcggccttgtcgtttattgaatgtggaaatgcgatggaacaaggccccatggag
tccaaatctccctacaccatgtactcggaaaccgtggagctcatcaggtatgctatgaga
ctaaaaactcactcaggtcccaatgccacaccagaggacaagcagctggccgcgttatgt
taccgatgcttggctctcctgtactggcggatgtttcgactcaagagggaccatgctgtc
aagtactcgaaagcactgatcgactatttcaagaattcatcaaaagccgcccaggccccg
tccccatggagcaccagtggaaagagcactggaaccccatcccccatgtctcccaacccc
tctcccaccagctccgtggggtctcagggcagcctctcgagcgccagctccctgtccccg
accaccatcatcagcatcccgcagcgcatccaccagatggcggccaaccacgtcagcatc
accaacagcattctgcacagctacgactactgggagatggccgacaacttggccaaggaa
aacagagaattcttcaacgacctggatctgctcatggggcctgtcaccctgcacagcagc
atggagcacctggtccagtactcccagcagggcctgcactggcttcggaacagcacccac
ctgtcctag

DBGET integrated database retrieval system