KEGG   Oryctolagus cuniculus (rabbit): 100348589
Entry
100348589         CDS       T03373                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu00240  Pyrimidine metabolism
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100348589 (DCK)
   00240 Pyrimidine metabolism
    100348589 (DCK)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100348589 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 DUF932 CoaE
Other DBs
NCBI-GeneID: 100348589
NCBI-ProteinID: XP_008265987
Ensembl: ENSOCUG00000001265
Position
15
AA seq 260 aa
MATPPKRSCPSPSTSSEGTRIKKVSIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLASLNGKLKDAE
NPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQNLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHESLVEKVREFLGTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccactccgcccaagagaagctgcccgtctccctccaccagctccgaggggacccgc
atcaagaaagtgtccatcgaagggaatatcgctgcagggaagtcaacatttgtgaatatt
cttaaacaagtctgcgaagactgggaagtggttcctgaacctgtagccagatggtgcaat
gttcaaagtactcaagatgaatttgaggaactaacaacgtctcagaaaagtggtgggaat
gttcttcagatgatgtatgaaaaacctgaacgatggtctttcaccttccaatcatatgcc
tgtctcagtcgaatacgagctcagcttgcttctctcaatggcaagctcaaggatgcagag
aaccctgtattattttttgaacgatcagtgtatagcgacaggtatatttttgcatctaat
ttatatgaatctgactgcatgaatgaaacggagtggacaatttatcaagactggcatgac
tggatgaataaccaatttggccagaaccttgaattggatggaatcatttatcttcgagct
actccagaaaaatgcttgaatagaatatatttacgtggaagaaatgaagagcaaggcatt
cctcttgaatatttagagaaacttcattataaacatgaaagctggctcttgcataggaca
ctgaaaaccaactttgattatctacaggaggtacctatcttaacattggatgttaatgaa
gactttaaagacaaacatgaaagtctggttgaaaaggtcagagaatttttgggaaccttg
tga

DBGET integrated database retrieval system