KEGG   Oryctolagus cuniculus (rabbit): 100348732Help
Entry
100348732         CDS       T03373                                 

Gene name
GOT2, FABP-1, FABPpm, mAspAT
Definition
(RefSeq) glutamic-oxaloacetic transaminase 2
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00220  Arginine biosynthesis
ocu00250  Alanine, aspartate and glutamate metabolism
ocu00270  Cysteine and methionine metabolism
ocu00330  Arginine and proline metabolism
ocu00350  Tyrosine metabolism
ocu00360  Phenylalanine metabolism
ocu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ocu01100  Metabolic pathways
ocu01200  Carbon metabolism
ocu01210  2-Oxocarboxylic acid metabolism
ocu01230  Biosynthesis of amino acids
ocu04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100348732 (GOT2)
   00270 Cysteine and methionine metabolism
    100348732 (GOT2)
   00220 Arginine biosynthesis
    100348732 (GOT2)
   00330 Arginine and proline metabolism
    100348732 (GOT2)
   00350 Tyrosine metabolism
    100348732 (GOT2)
   00360 Phenylalanine metabolism
    100348732 (GOT2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100348732 (GOT2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    100348732 (GOT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ocu01007]
    100348732 (GOT2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     100348732 (GOT2)
Amino acid related enzymes [BR:ocu01007]
 Aminotransferase (transaminase)
  Class I
   100348732 (GOT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 100348732
NCBI-ProteinID: XP_002711597
Ensembl: ENSOCUG00000003871
UniProt: P12345
Position
5
AA seq 430 aa AA seqDB search
MALLHSARVLSGVASAFHPGLAAAASARASSWWAHVEMGPPDPILGVTEAYKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKGLDKEYLPIGGLAEFCRASAELALGENSEV
VKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQSYR
YYDPKTCGFDFTGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVICKDADE
AKRVESQLKILIRPMYSNPPIHGARIASTILTSPDLRKQWLQEVKGMADRIIGMRTQLVS
NLKKEGSTHSWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVGY
LAHAIHQVTK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctgcactccgcccgcgtcctctccggggtcgcctccgccttccacccaggc
ctcgccgccgcagcctctgccagagccagctcctggtgggcccatgtggagatgggaccc
ccagatcctatcctgggagttacagaagcctacaagagagacacaaacagcaaaaagatg
aatctgggagttggcgcctaccgggatgataacgggaagccttacgtactccctagcgtc
cggaaggcagaggctcagattgctgcaaaaggtctcgacaaggaatacctgcccatcggg
ggactggctgagttctgtagggcatcggcagaactagccctgggcgagaacagcgaagtg
gtgaaaagcggccggtttgtcaccgtgcagaccatctctggaacgggggccctaaggatc
ggagccagttttctgcaaaggtttttcaagttcagccgagatgtctttctgcccaaacca
tcctggggaaatcacacacccatcttcagagatgctggcatgcagctacaaagctatcgg
tactatgaccccaagacttgcggttttgacttcacaggcgccctggaggacatctcaaaa
attccagagcaaagtgttcttctgttgcatgcctgtgcccacaatcccacaggagtggat
cctcggcctgagcagtggaaggaaatagcaacagtggtgaagaaaaggaatctgttcgcg
ttctttgacatggcctaccaaggctttgccagtggtgatggtgacaaggacgcctgggct
gtgcgccacttcattgaacagggcattaatgtgtgtctctgccagtcatacgccaagaac
atgggcttatatggtgaacgtgttggagccttcactgtgatctgcaaagatgcagatgaa
gccaaaagggtggagtcgcagttgaagatcttgatccgtccgatgtattccaaccctcct
atccatggggcccggattgcctccacgattctgacttccccggatttgcgaaagcaatgg
ttgcaggaagtgaaaggcatggcagaccgcatcattggcatgcggacccagctggtctcc
aacctcaagaaggaaggctccacccacagctggcagcacatcaccgaccagattggcatg
ttttgtttcacaggactaaagcctgaacaggtggagcggctgaccaaggagttctccatc
tacatgacaaaggacggtcgcatctctgtggctggcgtcacttctggcaatgtgggctac
cttgcccatgccattcaccaggtcaccaagtaa

DBGET integrated database retrieval system