KEGG   Oryctolagus cuniculus (rabbit): 100348736
Entry
100348736         CDS       T03373                                 

Gene name
CYP27A1, CYP27
Definition
(RefSeq) sterol 26-hydroxylase, mitochondrial
  KO
K00488  cholestanetriol 26-monooxygenase [EC:1.14.15.15]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00120  Primary bile acid biosynthesis
ocu01100  Metabolic pathways
ocu03320  PPAR signaling pathway
ocu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    100348736 (CYP27A1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100348736 (CYP27A1)
  09154 Digestive system
   04979 Cholesterol metabolism
    100348736 (CYP27A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ocu00199]
    100348736 (CYP27A1)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.15  cholestanetriol 26-monooxygenase
     100348736 (CYP27A1)
Cytochrome P450 [BR:ocu00199]
 Cytochrome P450, animal type
  CYP27 family
   100348736 (CYP27A1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100348736
NCBI-ProteinID: NP_001177359
Ensembl: ENSOCUG00000003377
UniProt: P17177
Position
7
AA seq 535 aa
MAALGCARLRWALLGPRVAGCGLCPQGARAKAAIPTALPADEAAQAPGAGPGDRRRRRSL
EELPRLGQLRFFYQAFVQGYLLHLHKLQVLNKARYGPMWVSYLGPQLFVNLASAPLVETV
MRQEGKYPVRNDMQLWKEHRDHQDLAYGVFTTDGHDWYQLRQALNQRLLKPAEAALYTDA
LNEVIDSFVVRLDQLRAESASGDQVPDMADLLYHFALEAICYILFEKRIGCLEASIPKDT
ENFIRSVGLMFQNSVYVTFLPKWTRPLLPFWKRYLDGWDTIFSFGKNLIDQKLQEVVAQL
QSAGSDGVQVSGYLHSLLTSGQLSPREALGSLPELLLAGVDTTSNTLTWALYHLSKNPEI
QAALRKEVVGVVAAGQVPQHKDFAHMPLLKAVLKETLRLYPVIPANSRIIVDKEIEVGGF
LFPKNTQFVFCHYVTSRDPSTFSEPDTFWPYRWLRKGQPETSKTQHPFGSVPFGYGVRAC
LGRRIAELEMQLLLARLIQRYELMLAPETGEVQSVARIVLVPNKKVGLRFLPTQR
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggctgcgctgggctgcgcgaggctgaggtgggcgctgctggggccgcgagtggccggc
tgtggcctctgcccacaaggagccagagccaaggccgcgatccccaccgccctccccgcg
gacgaagccgcccaggctcccggagccgggcctggggaccggcggcgacggcggagtctg
gaggagcttccgaggttagggcagctgcgtttcttctatcaggcgttcgtgcaaggctac
ttgctgcacctgcacaagctccaggtgctgaacaaggccaggtatggtccgatgtgggtg
tcctacctggggccccagttgtttgtgaacctggccagcgccccgctcgtggagacggtg
atgcggcaagagggcaagtacccggtccggaatgacatgcagctgtggaaggagcaccgc
gaccaccaggacctggcctacggggtcttcaccacggacggccacgactggtaccagctg
cgccaggctctgaaccagcgcttgctgaagccagcagaggccgcactctacactgatgct
ctcaatgaagtgattgacagctttgtggttcgactggaccagctgcgagcagagagcgcc
tcgggggaccaggtgcccgacatggctgacttgctctaccactttgctctagaagctatt
tgctacatcctgttcgagaaacgtatcggttgcctggaagcatccatccccaaggacacg
gagaacttcatcagatctgtagggctcatgttccagaactcagtctacgtcaccttcctc
cccaagtggacccgccccctgctgcccttctggaagcgctacctggacggctgggacacc
atcttctcctttgggaagaatctcattgatcagaaacttcaggaggtggtggcccagctg
cagtcagcggggtcagatggggtccaggtatccggctacctgcattccctgctgaccagt
ggacagctgagtccccgagaggccctgggcagcctgcccgagctcctgctggccggagtg
gacacgacgtccaacacgctcacgtgggccctataccacctttcaaagaacccagagatc
caggcggccttgcgcaaggaggtggtgggtgtggtggcagccgggcaggtgccgcagcac
aaggactttgcccacatgcccctgctcaaagcggtgctgaaggagaccctgcgtctgtac
ccggtgatccctgcaaactcccgcatcatcgtggacaaggagatcgaagtcggcggcttc
ctcttccccaagaacacccagtttgtgttctgccattatgtgacgtcccgggaccccagc
accttctctgagcctgacaccttctggccctaccgctggttgaggaaaggccagcccgag
acctctaagacccagcacccgtttggctctgtgccctttggctacggggtccgggcctgc
ctcggccgcaggatagcggaactagagatgcagctgctgctggccaggctgatccagcgg
tatgagctgatgctggcgcctgagacgggagaggtgcagagcgtggcccgcatcgtcctc
gttcccaataagaaggtgggcctgcgcttcctgcccacgcagcgctga

DBGET integrated database retrieval system