KEGG   Oryctolagus cuniculus (rabbit): 100349024Help
Entry
100349024         CDS       T03373                                 

Gene name
SLC4A1
Definition
(RefSeq) solute carrier family 4 member 1 (Diego blood group)
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    100349024 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100349024 (SLC4A1)
   04147 Exosome [BR:ocu04147]
    100349024 (SLC4A1)
   04090 CD molecules [BR:ocu04090]
    100349024 (SLC4A1)
Transporters [BR:ocu02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   100349024 (SLC4A1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100349024 (SLC4A1)
CD molecules [BR:ocu04090]
 Proteins
  100349024 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto MFS_MOT1
Motif
Other DBs
NCBI-GeneID: 100349024
NCBI-ProteinID: XP_002719226
Ensembl: ENSOCUG00000004499
UniProt: G1SLY0
Position
19
AA seq 919 aa AA seqDB search
MGDLQEDYEEVLGEILEEEEYEDPGVPMPQVEEPAASPFEPAPTDYHTTTSSHPGTREVY
VELQELVMDERNREPRWMEAAHWVRLEENLGQDGAWGRPHLSYLTFWSLLELQRVFAKGT
FLLDLPETSLAGVANQLLDRFIYEEQIRPQDRDELLRALLLKHSHTGDLEALGGVKPVVL
TRSGDPAEPLLPQQPSLETQLFCVQGEGGTEGQSPSGVLEKIPPDSEATLVLVGRATFLE
RPVLGFVRLQEAAMLEALELPVPVRFLLVLLGPEAPHTDYTQLGRAAATLMSERVFRTEA
YLTQSRGELVHSLEGFLDCSLVLPPTDVPSEQALLSLVPVQRELLRRRYLPSPAKPDPSF
YKGLDLNGGAGAPGEPEDPLQRTGRLFGGLVRDIRRRYPYYLSDITDALSPQVLAAVIFI
YFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFE
EAFFSFCESNNLEYIVGRAWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIF
IYETFSKLIKIFQDHPLQGRYDHNVVMKPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFK
NSSYFPGMLRRVIGDFGVPISILIMVLVDSFIQDTYTQKLSVPSGLQVSNSSARGWVIHP
LGLFSQFPIWMMFGAALPALLVFILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGM
GGVAALFGMPWLSATTVRSVTHANALTVMGKASSPGAAAQIQEVKEQRISGLLVSVLVGL
SILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLLKPPKYHPDVPFVKRVKTWR
MHLFTGIQIICLVALWVVKSTPASLALPFVLILTVPLRRLLLPYIFSNLELQCLDADDAK
ATFDEEEGRDEYDEVTMPV
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgggggatctgcaggaggactacgaagaggtgctgggggagattctggaggaggaggag
tatgaagaccccggggtccccatgccccaggtggaggagccggcagcctcccctttcgag
ccggcacccaccgactaccacaccaccacatcatcgcacccgggcacccgcgaggtctac
gtggagctgcaggagctggtgatggacgagcggaaccgggagccgcgatggatggaggcg
gcgcactgggtgaggctggaggagaacctgggccaggacggcgcctggggccgcccgcac
ctgtcctacctcaccttctggagccttctggagctgcagagagtcttcgccaagggcacc
ttcctcctggacctcccggagacctccctggccggggtagccaaccaactgctggacagg
tttatctacgaggagcagatccggccccaggaccgagatgagctgctccgggcgctgctg
ctgaaacacagccacaccggagacctggaggccctggggggtgtgaagcccgtggtcctg
acacgctctggggaccctgctgagccactgctcccccagcagccctcgctggagacgcag
ctcttctgtgtgcagggagagggcggcacggagggacagtcgccgtcgggagttctggaa
aagatccccccggattcggaggccaccctggtgctcgtgggccgggccaccttcctggag
cggccggtgctgggcttcgtgcggctgcaggaggcggcgatgctggaggccttggagctg
cctgtgcctgtgcgcttcctgctcgtgttgctggggcccgaggctccccacaccgactac
acccagcttggccgtgccgcagccaccctcatgtcagagagggtgttccgcaccgaggcc
tacctgacccagagccggggggagctggtgcactccctggagggctttctggactgcagt
ctggtgctgccgcccacggacgtgccctccgagcaggccctgctcagtctggtgcctgtg
cagagggagctgcttcggaggcgctacctgcccagcccggccaagccagaccccagcttc
tacaagggcctagacttgaacgggggtgctggggcccccggcgaaccagaggaccctctg
cagcggacaggccggctctttgggggcctggtgcgtgacatccggcgccgctacccttac
tacctgagcgacatcacagacgcgctcagcccccaggtcctggctgccgtcatcttcatt
tacttcgcagcgctgtcccccgccatcaccttcggcggcctcctgggagaaaagacccgg
aaccagatgggggtgtcggagctgctcatctccacggcggtgcagggcattctcttcgcc
ctgctgggggctcagcctctgcttgtggttggcttctcaggacccctgctggtgtttgag
gaagccttcttctcgttctgtgaaagcaacaacctggagtacatcgtgggccgggcgtgg
atcggcttctggctcatcctgctggtggtgctggtggtggccttcgagggcagcttcctg
gtccgcttcatctcgcgctacacccaggagatcttctccttcctcatctccctcatcttc
atctacgagaccttctccaagctgatcaagatcttccaggaccacccgctgcaggggcga
tacgaccacaatgtggtaatgaagcccaaacctcagggccccctgcccaacactgccctc
ctctctcttgtgctcatggccggcaccttcttctttgccatgatgctgcgcaagttcaag
aacagctcctacttccctggcatgctgcgtcgggtcatcggagactttggggtccccatc
tcaatcctgatcatggtcctggtggattccttcatccaggacacctacacccagaaactc
tcggtgcccagcggcctccaggtgtccaactcctcggccaggggctgggtcatccacccg
ctgggcttgttctcccagttccccatctggatgatgtttggggccgccctgccagccctg
ctggtcttcattctcatattcctggagtctcagatcaccacgctgatcgtcagcaaaccg
gaacgcaagatgatcaagggctccggcttccacctggacctgctgctggtcgtgggcatg
ggcggggtggccgccctcttcgggatgccctggctcagcgccaccactgtgcgttctgtc
actcacgccaatgctctcaccgtcatgggcaaggcgagcagcccaggggctgcggcccag
atccaggaggtcaaggagcagaggatcagcgggctcctggtctctgtgctcgtgggcctg
tccatcctcatggagcccatcctgtcccgcatccccctggccgtgctctttggcatcttc
ctctatatgggggtcacatctctcagcggcatccagctcttcgaccgcatcttgcttctg
ctcaagccacccaagtaccacccagacgtgcccttcgtcaagcgggtgaagacctggcgc
atgcacttgttcacgggcatccagatcatctgtctggtcgcgctgtgggtggtgaagtcc
acgcccgcctcactggccctgccctttgtcctcatcctcactgtgcccctgcggcgcctc
ctgctgccctatatcttcagcaacctggagctccagtgtctggatgccgacgacgccaag
gccacctttgacgaggaagaaggtcgggacgaatatgatgaagtgaccatgcctgtgtga

DBGET integrated database retrieval system