KEGG   Oryctolagus cuniculus (rabbit): 100349340Help
Entry
100349340         CDS       T03373                                 

Gene name
CTSO
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04142  Lysosome
ocu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100349340 (CTSO)
  09143 Cell growth and death
   04210 Apoptosis
    100349340 (CTSO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ocu01002]
    100349340 (CTSO)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     100349340 (CTSO)
Peptidases [BR:ocu01002]
 Cysteine Peptidases
  Family C1: papain family
   100349340 (CTSO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 Inhibitor_I29 Peptidase_C39_2
Motif
Other DBs
NCBI-GeneID: 100349340
NCBI-ProteinID: XP_002716930
Ensembl: ENSOCUG00000015469
UniProt: G1T9I0
Position
15
AA seq 309 aa AA seqDB search
MELRRLPWLWLLCCATFPGTWPRSPEREAAAFRESLNRHRYLNSFFSHENSTAFYGINQF
SYLFPEEFKAIYLRSQPSSSPRYPAEVKTSLLTVPLPLRFDWRDKHVVSQVRNQQMCGGC
WAFSVVGAVESTWAIKGHPLEDLSVQQVIDCSYNNYGCSGGSTLSALKWLNKTQVRLVND
SEYPFKARSGLCHYFPSSHSGLSIKGYSAYDFSDQEDEMAKSLLIYGPLVVIVDAVSWQD
YLGGVIQHHCSSGEANHAVLITGFDKTGSIPYWIVRNSWGSSWGVDGYAHVKMGSNVCGI
ADSVSAVFV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcggcggctgccctggctctggctgctgtgctgcgccaccttccccgggacc
tggccgcggagccccgagcgagaggccgccgccttccgggaaagtcttaatagacatcga
tacctgaattctttcttttctcacgaaaactccacagccttctatggaataaatcaattt
tcttatctgtttcctgaagagtttaaagccatctatttgagaagccagccttcctcatcc
cccagataccctgcggaagtgaagacgtccctcctcacagtgcccttgccattaagattt
gactggagggacaaacatgttgtgtctcaagtgagaaaccagcagatgtgtggaggatgc
tgggccttcagcgtggtgggtgccgtggaatccacgtgggcgataaagggacatcctttg
gaagatctgagtgtccagcaggtcattgattgttcatataacaattatggctgcagtgga
ggctccactctcagtgctttgaagtggttgaacaagacgcaggtgaggctggtgaatgat
tcggaatatcccttcaaagcacgcagcggcctttgccattactttcctagttcacattcc
gggctttcaatcaaaggttactctgcctatgacttcagtgaccaagaagatgaaatggcc
aagtcacttcttatctatggccctctggtagtcatagtcgacgcggtgagctggcaggat
tacctgggaggcgtaatacagcatcactgctcaagtggcgaagccaatcatgcagttctc
ataactggctttgataaaacagggagtataccatattggattgtccggaactcatgggga
agttcatggggagtggacggctatgcccatgttaaaatggggagtaacgtttgtggtatt
gcagattctgtttccgctgtatttgtgtga

DBGET integrated database retrieval system