KEGG   Oryctolagus cuniculus (rabbit): 100349464Help
Entry
100349464         CDS       T03373                                 

Gene name
ILKAP
Definition
(RefSeq) ILK associated serine/threonine phosphatase
  KO
K17500  integrin-linked kinase-associated serine/threonine phosphatase 2C [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100349464 (ILKAP)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100349464 (ILKAP)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    100349464 (ILKAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_2
Motif
Other DBs
NCBI-GeneID: 100349464
NCBI-ProteinID: XP_017195083
Ensembl: ENSOCUG00000017442
Position
Un
AA seq 352 aa AA seqDB search
MASGPGGPLLFDGLPPAGSGDPGSLATSVSQSGRSDGKGAKRKTSEEENGSEEPVEKKVS
SSVIFSLKGYVAERKGEREEMQDAHVILNDITEECRPPSSLITRVSYFAVFDGHGGIRAS
KFAAQNLHQNLIRKFPKGDVISVEKTVKRCLLDTFKHTDEEFLKQASSQKPAWKDGSTAT
CVLAVDNILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRD
GRVLGVLEVSRSIGDGQYKRCGVTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNF
ILSCLEDEKIQSREGRPAVDVRYEAACNRLASKAVQRGSADNVTVMVVRIGQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagggccagggggacctttgctttttgatggcctcccacctgctggcagtggc
gatccaggttcccttgccacttccgtatcccagtcggggaggagtgacgggaagggagcg
aagcggaagacctccgaggaagagaacggcagcgaagagcctgtggaaaagaaagtttcc
tcgtcggtgatcttcagtctgaagggctatgtggccgagcggaagggtgagagggaggag
atgcaggacgcccacgtcatcctgaacgacatcaccgaggagtgcaggcctccgtcatcc
ctcatcactcgggtttcgtattttgctgtttttgatggacacggaggaattcgagcctca
aagttcgctgcacagaatctccatcagaacttaatcaggaagttccctaaaggagacgtg
atcagtgtggagaagaccgtgaagagatgcctcctggacacatttaagcacactgatgaa
gagttcctgaaacaagcttcgagccagaagcctgcctggaaggacgggtccactgccacg
tgtgtcctcgccgtggacaacatcctttacatcgccaaccttggagacagccgggcaatc
ctgtgtcgttacaatgaggagagtcagaaacacgcagccttaagcctcagcaaagagcat
aaccccacccagtatgaagaacggatgagaatacagaaggctggagggaatgtcagggat
gggcgtgtcctgggcgtgctagaggtgtctcgttccattggcgacgggcagtacaagcgc
tgtggggtcacgtctgtgccagatatcaggcgctgccaactgacgcccaatgacaggttc
atcttgctggcctgtgatgggctcttcaaggtcttcactccggaagaagccgtgaacttc
atcttgtcctgccttgaggacgagaagatacagagccgggaaggcaggcccgccgtggac
gtccgctacgaagctgcctgcaacaggctggccagcaaggcggtgcagcgcggctccgcc
gacaacgtcaccgtgatggtggtgcggatagggcagtga

DBGET integrated database retrieval system