KEGG   Oryctolagus cuniculus (rabbit): 100352057Help
Entry
100352057         CDS       T03373                                 

Definition
(RefSeq) 40S ribosomal protein S8
  KO
K02995  small subunit ribosomal protein S8e
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03010  Ribosome
Module
ocu_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100352057
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ocu03011]
    100352057
Ribosome [BR:ocu03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    100352057
  Archaea
    100352057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S8e ICAT
Motif
Other DBs
NCBI-GeneID: 100352057
NCBI-ProteinID: XP_002708870
Ensembl: ENSOCUG00000017511
UniProt: G1TJW1
Structure
PDB: 

Position
1
AA seq 208 aa AA seqDB search
MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVGVRGGNKKYRALRL
DVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLIDSTPYRQWYESHYALP
LGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPG
QCGRADGYVLEGKELEFYLRKIKARKGK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgggcatctctcgggacaactggcacaagcgccgcaaaactgggggcaaaagaaagccc
taccataagaagcggaagtatgagctgggccgcccggctgccaacacgaagatcggcccc
cggcggatacataccgtgggagttcgaggaggcaataagaagtaccgggccctgcggctg
gacgtggggaacttctcctggggctccgagtgttgtacccgcaaaacaaggatcatcgat
gttgtctacaatgcctccaataacgagctggtccgcaccaaaaccctggtgaagaactgc
atcgtgcttatagacagcacgccgtaccgacagtggtacgagtcccactacgcgctgccc
ctgggccgcaagaagggggccaagctgactcctgaggaggaagaaattttaaacaaaaaa
cgatcaaagaagattcagaagaaatacgacgaaaggaagaagaatgccaagatcagcagt
ctgctggaggagcagttccagcagggcaagctgctcgcgtgcattgcgtcaagacctggc
cagtgtggccgagcagatggctatgtactagaaggcaaggagctggagttctatctgagg
aaaatcaaggcccggaaaggcaaataa

DBGET integrated database retrieval system