KEGG   Oryctolagus cuniculus (rabbit): 100352256
Entry
100352256         CDS       T03373                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100352256 (ERAP1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100352256 (ERAP1)
Peptidases and inhibitors [BR:ocu01002]
 Metallo peptidases
  Family M1
   100352256 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N SesA
Other DBs
NCBI-GeneID: 100352256
NCBI-ProteinID: XP_002713989
Ensembl: ENSOCUG00000007820
Position
11
AA seq 942 aa
MESPPLGRPRASMPFLLRSLLALLALSTPSQCQDSEATSPKATNGTPFPWDKMRLPEHVI
PVHYDLTIHANLTTLTFWGTTEVEVTASRPTSTIILHSHRLQISKATLRRRAGQGLLQEP
LRVLEYPRHEQIALLAPEPLLVGLPYTVVIDYAGNLSDTFHGFYKSTYRTKEGEVRVLAS
TQFEPTAARMAFPCFDEPAFKANFSIKIRREPRHLAISNMPLVKSVTVAEGLVEDQFDVT
VKMSTYLVAFIVSDFESVSKVTKSGVKVSVYAVPEKINQAAYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDVEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFLGKCFNAMEVDALNSSHPV
STPVENPAQILEMFDEVSYEKGACILNMLRDYLGADAFKSGIVQYLREYSYRNTKNEDLW
NSMARICPAGGMQETEGFCSRGQHSSSSSHWRQEVLDVKAMMNTWTLQKGFPLVTVTVRG
RNVHLEQEHYMKGADGAPETGYLWHVPLTFITSKSDVVQRFLLKTKTDVLLLPEAVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGAHTAISRNDRASLINSAFQLVSIGKLSIEKALD
LSLYLKHETEIMPVFQGLNELIPMYKLMEKREMDEVETQFKAFLIRLLQGLIDAQTWTDD
GSVSERMLRSQLLLLACVRKYEPCVRQAEGHFRRWKDSNGTLSLPNDVTLAVFAVGAQDT
EGWNFLYNKYRSSLSSTEKSQIEFALCTSQDQEKLQWLLDDSFKGDVIKTQEFPYILTLI
GRNPVGYPLAWQFLRENWNKLVQKFELGSASIAHMVTGTTNQFSTRARLEEVKGFFSSLK
DNGSQLRCVQQTLETIEENIRWMDKNFDKIRVWLQSEKPELQ
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggagtcgccgcccctgggaaggccgcgtgcaagcatgccatttctgcttcgttcactc
ttggctctcttagccctgtcaactccctcacagtgtcaggacagtgaagcgacgtctccc
aaggcgacgaacgggaccccattcccgtgggataaaatgcggcttcctgagcacgtcatt
ccggttcattacgacctcacgatccacgcaaatctcaccacgctgaccttctggggaacc
acggaagtcgaggtcacagccagccggcccaccagcaccatcatcctgcacagtcaccgc
ctgcagatctctaaggccacgctcaggagaagagctggacaggggctgctgcaagaaccg
ctgagggtcctggaatatccccgccacgagcaaattgcccttctggcccccgagcccctg
ctggtggggctcccctacacggtcgtcatcgactacgctggcaacctctctgacaccttc
cacggcttctacaaaagcacctaccgcaccaaggagggggaagtcagggtactggcatca
acccagttcgaacccactgccgctagaatggcctttccctgtttcgacgaacctgccttc
aaagccaatttctccatcaagatcagaagggagccgcgacacctcgccatctccaatatg
ccactggtaaaatccgtgacggttgctgagggactcgtggaagaccagttcgatgtcacc
gtgaagatgagcacctacctggtggccttcattgtttcagacttcgaatctgtcagcaag
gtgaccaagagcggagtgaaggtttctgtctatgctgtgccagagaagatcaatcaggca
gcttacgcgctggatgccgcagtgactctgctggagttctatgaggactacttcagcata
ccgtatcccttacccaaacaagaccttgctgctattcctgacttccagtctggtgccatg
gaaaactgggggctgacgacctacagagaatctgctctgctgttcgatgtggaaaagtct
tcggcatccagcaagctcggcatcaccatgaccgtgtctcacgagctcgcccaccagtgg
tttgggaacctggtcactatggaatggtggaatgatctttggctgaatgaaggatttgcc
aagtttatggaatttgtgtctgtcagtgtgacccatccggagctgaaagttgaagattac
ttcttgggcaagtgtttcaatgcaatggaggtcgacgccttaaactcctcgcaccccgtg
tccacccctgtggagaatcctgctcagatcttggagatgtttgatgaggtttcctatgag
aagggtgcctgcattctgaacatgctgagagattacctgggtgccgatgcctttaagagt
ggtatcgtgcagtatctccgtgagtacagctataggaacaccaagaacgaggacctgtgg
aacagcatggccaggatctgccctgcgggcggcatgcaagagacagagggcttttgctct
agaggccagcattcgtcttcgtcctcgcactggcgtcaggaagtcctggacgtgaaagcc
atgatgaacacctggacgctgcagaagggctttcccctggtgaccgtcacggtgagaggg
aggaacgtgcacctggagcaagagcactacatgaagggagctgacggcgccccggaaacc
gggtatttgtggcatgttccgttgacgttcattaccagcaaatcggatgtggtccaaaga
tttttgctgaagacaaaaacagacgtgctgctcctcccagaagcggtggaatggatcaag
tttaacgtggggatgaacggctattacatcgtgcattacgaggatgacggatgggattct
ttgactggccttctgaaaggggcgcacacggcaatcagcagaaatgaccgggcgagtctc
attaacagcgcgtttcagcttgtcagcattggaaaactgtcgatcgaaaaagccttggat
ttatcgctgtacttgaaacacgaaactgaaattatgcccgtgttccaaggtctgaatgag
ttgataccgatgtacaagttaatggagaaacgagagatggatgaagtggaaactcaattc
aaggccttcctcatccggctgctgcagggcctcatcgacgcacagacgtggacggacgac
ggctcggtgtcggagcgcatgctgcggagccagctcctgctgctggcctgcgtgcgcaag
tacgagccgtgcgtgcgccaggccgagggccacttccgcaggtggaaggactccaacggg
actctgagcctgcccaacgacgtgaccttggcagtgtttgccgtgggggcccaggacacg
gaaggctggaattttctgtataacaaatatcggtcgtctctgtccagtactgagaaaagc
caaattgaatttgccctctgtacaagccaagatcaggagaagcttcaatggctgctagat
gacagtttcaagggagatgtaattaagactcaggagttcccatatatcctcacactgatt
ggcagaaacccagtggggtatccgttggcctggcagttcttgagggaaaactggaacaaa
cttgtgcaaaagtttgaacttggttcagcttccatagcccacatggtaacgggaacaaca
aatcaattctccacaagagcacggcttgaagaggtaaaaggattcttcagctctttgaaa
gacaatggttcacagctccgttgtgtccaacaaacgctcgaaaccatcgaggaaaacata
cgctggatggataagaactttgataagatccgagtgtggctgcaaagtgagaagcctgaa
ctccagtag

DBGET integrated database retrieval system