KEGG   Oryctolagus cuniculus (rabbit): 100352959Help
Entry
100352959         CDS       T03373                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock protein family A (Hsp70) member 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03040  Spliceosome
ocu04010  MAPK signaling pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04144  Endocytosis
ocu04213  Longevity regulating pathway - multiple species
ocu04612  Antigen processing and presentation
ocu04915  Estrogen signaling pathway
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05162  Measles
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100352959 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100352959 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100352959 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100352959 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100352959 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100352959 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100352959 (HSPA2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100352959 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    100352959 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100352959 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100352959 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ocu03041]
    100352959 (HSPA2)
   03009 Ribosome biogenesis [BR:ocu03009]
    100352959 (HSPA2)
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100352959 (HSPA2)
   04131 Membrane trafficking [BR:ocu04131]
    100352959 (HSPA2)
   03051 Proteasome [BR:ocu03051]
    100352959 (HSPA2)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100352959 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100352959 (HSPA2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100352959 (HSPA2)
Spliceosome [BR:ocu03041]
 Complex B
  Other components
   Prp19 complex
    100352959 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    100352959 (HSPA2)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100352959 (HSPA2)
Chaperones and folding catalysts [BR:ocu03110]
 Heat shock proteins
  HSP70 / DNAK
   100352959 (HSPA2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100352959 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100352959 (HSPA2)
Proteasome [BR:ocu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100352959 (HSPA2)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100352959 (HSPA2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100352959 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG CRIC_ras_sig DUF1464 DDR Zincin_2
Motif
Other DBs
NCBI-GeneID: 100352959
NCBI-ProteinID: XP_002719605
Ensembl: ENSOCUG00000011745
UniProt: G1T1V9
Position
20
AA seq 635 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPANTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEVKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRERVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKSKILDKCQEVISWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGSGGSGGPTIEEVD
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgcggcccggccatcggcattgacctgggcaccacctactcgtgcgtgggc
gtgttccagcacggtaaagtggagatcatcgccaacgaccagggcaaccgcaccacgccc
agctacgtggccttcacggacacggagcgcctcatcggcgacgcggccaagaaccaggtg
gccatgaaccccgccaacaccatcttcgacgccaagcggctgatcggccgcaagttcgag
gacgccacggtgcagtcggacatgaagcactggccgttccgcgtggtgagcgagggcggc
aagcccaaggtgcaggtggagtacaagggcgaggtgaagaccttcttcccggaggagatc
tcgtccatggtgctgacgaagatgaaggagatcgccgaggcctacctgggcggcaaggtg
cagagcgccgtcatcacggtgccggcctacttcaacgactcgcagcgccaggccaccaag
gacgcgggcaccatcacgggcctcaacgtgctgcgcatcatcaacgagcccacggcggcc
gccatcgcctacgggctggacaagaagggctgcgcgggcggcgagaagaacgtgctcatc
ttcgacctgggcggcggcaccttcgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtcgacggccggcgacacgcacctgggcggcgaggacttcgacaaccgcatg
gtgagccacctggccgaggagttcaagcgcaagcacaagaaggacatcgggcccaacaag
cgcgccgtgcggcggctgcgcacggcctgcgagcgcgccaagcgcacgctgagctcgtcc
acgcaggccagcatcgagatcgactcgctctacgagggcgtggacttctacacgtccatc
acgcgcgcccgcttcgaggagctcaacgccgacctgttccgcggcacgctggagccggtg
gagaaggcgctgcgcgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccacgcgcatccccaagatccagaagctgctgcaggacttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggccgtggcctacggcgccgcggtgcaggcc
gccatcctcatcggcgacaagtccgagaacgtgcaggacctgctgctgctggacgtgacg
cccctgtcgctgggcatcgagacggcgggcggggtcatgaccccgctcatcaagaggaac
accacgatccccaccaagcagacgcagaccttcaccacctactcggacaaccagagcagc
gtgctggtgcaggtgtacgagggcgagcgcgccatgaccaaggacaataacctgctgggc
aagttcgacctgaccgggatccccccggcgccccgcggggtgccccagatcgaggtcacc
ttcgatatcgacgccaacggcatcctcaacgtgaccgccgccgacaagagcaccggcaag
gagaacaagatcaccatcaccaacgacaagggtcgcctgagcaaggacgacatcgaccgc
atggtgcaggaggcggagcgctacaagtcggaggacgaggcgaaccgcgagcgggtggcg
gccaagaacgccgtggagtcctacacctacaacatcaagcagacggtggaggacgagaag
ctgcggggcaagatcagcgagcaggacaaaagcaagatcctcgacaagtgtcaggaggtg
atcagctggctggaccggaaccagatggccgagaaagacgagtacgagcacaagcagaaa
gagctggaaagagtgtgcaaccccatcatcagcaaactttaccagggcgggcctggcggc
ggcggctccggcggctccgggggaccgaccatcgaggaagtggactaa

DBGET integrated database retrieval system