KEGG   Oryctolagus cuniculus (rabbit): 100355185Help
Entry
100355185         CDS       T03373                                 

Gene name
CAMKMT
Definition
(RefSeq) calmodulin-lysine N-methyltransferase
  KO
K18826  calmodulin-lysine N-methyltransferase [EC:2.1.1.60]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00310  Lysine degradation
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100355185 (CAMKMT)
Enzymes [BR:ocu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.60  calmodulin-lysine N-methyltransferase
     100355185 (CAMKMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_16 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12
Motif
Other DBs
NCBI-GeneID: 100355185
NCBI-ProteinID: XP_002709937
Position
2
AA seq 324 aa AA seqDB search
MESSVTDSGVGETERATGGVSDIGGAAQGSPVSAPLGAARWKLLRQVLRQKHLDGCLRHI
SVRRFESFNLFSKTEAFEKRETEEEVGAWVQYTSVFYPEYSVFLRHNSGSLNVGDVLTSF
DNTGNVCIWPSEEVLAYYCLKHSHTFRDLAVCELGGGMTCLAGLMVAISADVKEVLLTDG
NEKAIRNVRDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEGHFDIVMCADCLFLDQY
RASLVDALKRLLQPRGKAMVFAPRRGNTLNQFCNLAEKAGFSIQRHENYDEHISNFHSKL
KKENPDLYEENLHYPLLLILTKSG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggagtccagtgtcacggacagcggggttggcgagacggagcgagccacgggtggggtc
tcggacattggcggcgccgctcaggggtcaccagtctcggcgcccctcggagctgcccgg
tggaagctcctgcggcaggttctgaggcagaaacacctggatggttgtctgcgacacata
tctgtaagaagatttgagtcatttaatctgttttcaaaaacagaagcttttgaaaaacgg
gaaactgaagaggaggttggtgcgtgggtccagtacacaagtgtcttctatcctgaatac
agtgtcttcttaaggcataatagtggatctttgaatgtgggagatgttcttaccagcttt
gacaatacaggaaatgtttgcatttggccatctgaagaggttttggcatactactgcctc
aagcacagtcacacattcagggaccttgctgtgtgtgagctagggggtggcatgacatgc
ttggctgggctcatggttgctatttctgcagatgtcaaagaagttctgttaactgatggg
aatgaaaaggccatcagaaacgtgagagacatcatcacgagaaaccagaaggctggtgtg
tttaaaacgcagaaaatatcaagctgcgttttacgatgggataatgagacagatgtctct
caactggaaggacattttgacattgttatgtgtgctgactgcctgtttctggaccagtac
agagccagccttgttgatgcattaaagagattactccagcccagggggaaagcaatggta
ttcgccccacgccgtgggaatactttaaaccagttttgcaatctagctgaaaaagctggt
ttctctatccaaagacatgaaaattatgatgaacacatttcaaacttccactccaagttg
aaaaaggaaaacccggacctatatgaagaaaaccttcattacccccttctgcttatttta
accaaatccgggtag

DBGET integrated database retrieval system