KEGG   Oryctolagus cuniculus (rabbit): 100355634Help
Entry
100355634         CDS       T03373                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100355634 (DOCK7)
Membrane trafficking [BR:ocu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    100355634 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N Elong_Iki1 TEA
Motif
Other DBs
NCBI-GeneID: 100355634
NCBI-ProteinID: XP_008263368
Ensembl: ENSOCUG00000012948
Position
13
AA seq 2023 aa AA seqDB search
MDPHVRDCIRSYTEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQVFETDEAPDGNN
YQDEQDDLKRRSMSIDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDRQNDDQRK
SNRHKELFALHPSPDEEEPIERLSVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALY
DVKEKKKISENFYFDLNSEQMKGLLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEK
VLQQGDIGECAEPYMIFKEADATKNKEKLEKLKSQADQFCQRLGKYRMPFAWTAIHLMNI
VSSAGSLERDSTEVEISTGERKGSWSERRNSSIVGRRSLERTTSGDDACNLTSFRPATLT
VTNFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPEL
LQVKLYPDSRVRPTREILEFPARDVYVPNTTYRNLLYIYPQSLNFANRQGSARNITVKVQ
FMYGEDPSNAMPVIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLF
TFYHVSCQQKQNTPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLP
GMKWVDNHKGVFNVEVVAVSSIHTQDPYLDKFFALVNALDEHMFPVRIGDMRIMENNLEN
ELKSSISALNSSQLEPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRL
HKNLEGNHDQHGRNSLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPAS
LNLNRSRSLSNSNPDISGTPTSPDDEVRSIIGNKGLDRSNSWVNTGGPKAAPWGSNPSPS
AESTQGMDRGCNRMSSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVRESALQQA
WFFFELMVKSMVHHLYFNDKLDAPRKSRFPERFMDDIAALVSTIASDIVSRFQKDTEMVE
RLNTSLAFFLNDLLSVMDRGFVFSLIKSCYKQVSSKLYSLPNPSVLVSLRLDFLRIICSH
EHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAG
LVLTELAVILDPDAEGLFGLHKKVINMVHNLLSSHDSDPRSSDPQIKARVAMLYLPLIGI
IMETVPQLYDFTETHNQRGRPICIAPDDYESESGSMISQTVAMAIAGTSVPQLTRPGSFL
LTSTSGRQHTTFSAESSRSLLICLLWVLKNADETVLQKWFTDLSVLQLNRLLDLLYLCVS
CFEYKGKKVFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFG
SQENLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVT
ESKESILGGVLKVLLHSMACNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRL
LRHCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLR
RSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIA
KGYQTSPDLRLTWLQNMAGKHSERSNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVT
FQNISSNVLEESAVSDDVVSPDEEGICSGKYFTESGLVGLLEQAAASFSMAGMYEAVNEV
YKVLIPIHEANRDAKKLSTIHGKLQEAFSKIVHQSTGWERMFGTYFRVGFYGTKFGDLDE
QEFVYKEPAITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDANKAYIQITYVE
PYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIK
TRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGP
LEVAQVFLSEIPSDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERN
YHRLKEALQPLINRKIPQLYKAVLPVTCHRDSFSRMSLRKMDL
NT seq 6072 nt NT seq  +upstreamnt  +downstreamnt
atggatccacatgttagagattgtataagaagttatacagaagactgggcaattgtgaac
agaaaataccataaactgggaacaggatttaatcccaatacattagataagcagaaagaa
aggcaaaaaggtttgccaaagcaggtctttgaaactgatgaagctccagatggcaacaac
taccaggatgagcaagatgatcttaaaagacgttcaatgtcaatagatgatactccaagg
ggtagttgggcctgcagtatctttgacttgaaaaattcgcttcctgatgctttgctcccc
aatttacttgaccgaacgccaaatgaagaaatcgaccgtcagaatgatgaccaaaggaaa
tcaaaccgtcataaagaactctttgctttgcatccatcaccagatgaggaagaaccaata
gaacgacttagtgttcctgatgtacccaaagaacattttggtcaaagacttcttgtaaaa
tgtttatctctcaagtttgaaattgaaattgaacccatatttgcaagtttggctttatat
gatgtcaaggaaaagaaaaagatttcagaaaacttttattttgaccttaattctgagcag
atgaaaggattattacgtccacatgtgcctcctgctgccattaccactctggcaagatca
gctattttttctatcacttacccttcacaagatgtttttcttgtaataaagctagaaaaa
gtcctacaacaaggagatattggagagtgtgcagaaccatatatgattttcaaagaagca
gatgccactaagaataaggaaaaattggagaagctgaaaagtcaagctgatcagttttgc
cagagacttgggaaatatcgcatgccttttgcttggactgcaatccatttaatgaatatt
gttagcagtgctgggagtttagaaagagattctacagaagtagaaattagtactggagaa
cgaaaaggatcttggtcagagcggagaaattctagtattgttggcagacgatcacttgaa
aggacaacaagtggagatgatgcctgtaatttgactagctttcgaccagctactctgaca
gtgacgaatttttttaagcaggaaggagatcgcttaagtgatgaagatctgtacaaattc
cttgctgacatgagaaggccatcatctgttttacggcgactaagacctatcacagctcaa
ctgaagatagacatttctcctgctcctgaaaatcctcattattgcctcaccccggagctg
cttcaagtgaagctttaccccgacagtagagttagacctacaagggaaattttggagttt
ccagccagggatgtctatgttccaaacactacttacagaaatctgctttacatataccct
cagagtcttaattttgccaatcgtcaaggttctgccagaaatataacagtgaaagtccaa
tttatgtatggggaggatccaagcaatgctatgccggtaatctttggtaaatctagctgt
tcagaattttcaaaggaagcctatacagccgtagtatatcataacaggtctcccgatttt
catgaagaaatcaaagttaaactccctgctactttaactgaccatcatcacttgcttttt
actttttatcatgttagttgtcaacaaaaacagaatactcctcttgaaaccccagttgga
tacacatggataccaatgcttcagaatggacgattgaagactggccagttttgtctcccg
gtctcactggaaaaaccaccgcaggcttactcagtactgtctcctgaggtccctctgcct
ggcatgaaatgggtagataaccacaaaggtgtttttaatgttgaagttgttgccgtttca
tctatccatacacaagatccttatcttgacaagttttttgccctggtcaatgctctggat
gaacacatgttcccagtccgaattggggacatgagaatcatggaaaataacttagaaaat
gaattgaagagcagtatttcagcattgaattcatctcagttggaaccagtggtccgattt
cttcaccttctgcttgataaactgatactcttagttgttagacctcctgtcattgctggc
caaatagttaatctaggtcaagcgtcttttgaagccatggcatcaattataaatcgactt
cataaaaacttggaaggaaatcatgaccagcatggcagaaatagccttcttgcatcatat
atttactatgtttttcgcctaccgaatacttaccctaattcaccatcaccaggtcccggg
ggcttgggaggatcagtgcattatgccacaatggctagatctgctgtaagacctgcaagc
cttaatttaaatcggtctcggagccttagtaatagtaatccagatatatctgggactccc
acttcaccagatgatgaagttcggtcaatcatcggtaataagggtttagatcgctccaat
tcctgggttaacactggtggtccaaaagctgccccatggggatccaaccccagtccaagt
gcagaatcaacacagggtatggatcgaggttgtaatcgtatgtcttcgcacacagagact
tcaagtttcttacaaacattaacgggacgcttaccaactaaaaagctttttcatgaggag
ctggctctgcagtgggttgtttgcagtggcagtgttcgtgaatcagctttgcaacaagcc
tggttctttttcgagttaatggttaaaagcatggtgcaccatttatactttaatgataaa
cttgatgctccaaggaaaagtcgttttccagaacgtttcatggatgacattgctgctctt
gtcagcacaattgctagtgatatagtctcacgatttcagaaggacacagaaatggttgag
agactcaatacaagccttgcattctttctcaatgatctgctgtctgttatggacagagga
tttgtttttagccttataaagtcctgctataaacaggtgtcttcaaagctttactcctta
ccaaatccaagtgtcctggtgtccttgaggttggatttcctgcggatcatctgtagtcac
gagcactacgttacattaaacttgccctgcagcttacttactcccccggcttctccctca
ccttctgtttcttctgcaacatctcagagttctggattttccacaaatgtgcaggaccag
aagattgcaaatatgtttgaactgtctgtgcctttccgccaacagcattatttggcaggc
cttgtgttaacagaactggctgtcattttagaccctgatgctgaaggactgtttggattg
cataagaaagtcatcaatatggtacacaatttactctccagtcatgactcagacccacgg
tcctctgacccccagataaaggctcgggtggccatgttgtatctacctctgattggtatt
atcatggaaactgtgcctcagctgtatgattttacagaaactcacaatcaacgaggaaga
ccaatttgtatagcccctgatgattatgaaagtgagagtggaagcatgataagccagacc
gttgccatggcaattgcgggaacatcagtccctcaactaacaagacctggcagtttcctc
ctcacgtccacgagtggcaggcaacatactaccttctcagcagaatcgagtcggagcctt
ttgatctgtctactctgggttctcaagaatgcagatgaaacagttctacagaagtggttt
actgatctgtcagtcctgcaactaaaccgactgttagatctgctttatctctgtgtgtca
tgctttgagtacaaagggaaaaaggtgtttgaaagaatgaatagtttgacttttaagaaa
tcaaaagacatgagagcaaaacttgaagaagctatccttgggagcataggtgctaggcaa
gaaatggtgcgccgaagccgaggacagcttgagagaagtccatctgggagtgcctttgga
agtcaagaaaatctaaggtggagaaaggacatgactcactggcgtcagaacacagagaag
cttgacaagtcaagagcagagattgaacatgaagcacttattgatgggaacctggctact
gaagcaaatctaattattttggatacattagagattgttgtccagacggtgtccgtaaca
gaatccaaagagagcatccttggtggcgtgctcaaagtcctgctgcatagcatggcctgt
aaccaaagtgcggtttatctacagcactgctttgctacacagagagccctggtttcaaag
ttcccagaactgctatttgaagaagagacggagcaatgtgctgacttatgcctgcggctt
ctccgacactgtagcagtagcatcagtacaatacggtcgcatgctagtgcctccctttac
ctcctaatgagacaaaactttgaaattgggaataattttgccagggttaaaatgcaggta
acaatgtcactatcctccctggtgggcacatctcagaattttaatgaagaattcttaaga
cgttctctaaagactatattgacgtatgctgaagaagatttggaattgagggaaacaaca
tttcctgatcaggtccaagatctggtatttaatctccatatgatcctttcggatactgtt
aaaatgaaggaacaccaagaggatcctgaaatgttgattgatctgatgtacagaattgcc
aagggttaccagacctctccagatttgcgattaacctggttgcagaacatggctggcaaa
cactcagagcgcagcaatcacgctgaagctgcacagtgcctcgtccactcagcagcactc
gtggctgagtatctgagcatgctggaggaccggaaatacctccctgtgggatgcgtaaca
tttcagaatatttcatctaatgttttagaagaatctgcagtctcagatgatgtagtatct
ccagatgaagaaggtatctgctctggaaagtactttactgagtcaggacttgtgggatta
ttggaacaagcagccgcttctttctctatggctggcatgtatgaagcagttaatgaagtt
tacaaagtacttatccctattcatgaagctaatcgtgatgcaaagaaactatccacaatt
catggtaaacttcaagaagcattcagcaaaattgttcatcagagtactggctgggagcgg
atgtttggcacctattttcgtgttggtttttatggaaccaagttcggggatttggatgaa
caggagtttgtttacaaggagcctgcaataaccaaacttgcagagatatctcacagattg
gagggattttatggagaaagatttggtgaggatgtggttgaagtaatcaaggactccaat
cctgtagacaagtgtaaattagatgctaacaaggcatatattcagattacctatgtggaa
ccatacttcgatacatatgagatgaaagacagaatcacatattttgacaaaaattataac
cttcgccgtttcatgtactgtacaccattcactttagatggccgtgcccatggagaactt
catgagcaattcaaacggaaaaccattctgaccacttctcatgcctttccttatattaaa
acaagggtcaatgtcactcacaaagaggagatcatcttaacaccaattgaagttgctatt
gaagacatgcagaaaaagacgcaggagttggcatttgcgacacatcaagacccagcagac
cccaaaatgctacagatggtactccagggatctgtaggcacaacagtgaatcagggacct
ttggaagttgcccaggttttcttatctgaaatacccagtgacccaaagctgtttagacat
cataataaactgcgactctgctttaaagattttactaaaaggtgtgaagatgccttaagg
aaaaataagagcttaattgggccagatcagaaggagtatcagagggaactagagagaaac
tatcatcgtcttaaagaggccctgcaaccactgataaacagaaagatccctcagttatat
aaggcagtgttgcctgtcacttgccacagagattccttcagccgaatgagccttcgcaaa
atggatctctaa

DBGET integrated database retrieval system