KEGG   Oryctolagus cuniculus (rabbit): 100355792Help
Entry
100355792         CDS       T03373                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    100355792 (ABHD6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ocu01002]
    100355792 (ABHD6)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100355792 (ABHD6)
Peptidases [BR:ocu01002]
 Serine Peptidases
  Family S33
   100355792 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 FSH1 BAAT_C DLH Lipase C9orf72-like DUF2048 Esterase Thioesterase PhnG
Motif
Other DBs
NCBI-GeneID: 100355792
NCBI-ProteinID: XP_002713318
Ensembl: ENSOCUG00000000832
UniProt: G1SE63
Position
9
AA seq 338 aa AA seqDB search
MMDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEGYQ
FCYSFRGRPGSKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDL
SIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGHVAGVYAAYYPSDIASLCLVCPAGLQYS
TDNQFVQRLKELQDSAAMQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRLPH
NNFYRKLFLEIVSEKSRYSLHKNMDKIKVPTQIIWGKQDQVLDVSGADVLAKSITNCQVE
LLENCGHSVVMERPRKTAKLMVDFLASVHNTDNNKKLD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgatggatctggacgtggttaacatgtttgtgatcgcggggggaactctggccatccca
atcctggcatttgtagcctcattcctcctgtggccctcggctctgatcagaatctactat
tggtactggcggaggacgctgggcatgcaggtgcgctacgttcaccacgaaggctatcag
ttctgctattccttccggggcaggccggggtccaagccctccatcctcatgctccatgga
ttctccgcacacaaggatatgtggctcagcgtggtcaagttccttccgaagaacttgcac
ttggtctgtgtggacatgccaggacatgagggaaccacccgctcctccctggatgaccta
tccatagatggacaagtcaagaggatacatcagtttgtagaatgcctgaaactgaacaaa
aagcccttccatctagtgggcacctccatgggcggccacgtggctggtgtgtatgctgct
tactacccatcggatattgccagcctatgtctcgtgtgccctgctggcctgcagtattca
actgataatcagtttgttcaacggctcaaagaactacaagactcagctgccatgcagaag
atccctctgatcccatccaccccggaagagatgagtgaaatgctccaactctgctcttac
gtccgcttcaaggtgccccagcagatcctgcagggcctcgtggatgtccgcctccctcac
aacaacttctacaggaagttgtttttggaaatcgtcagtgagaagtccagatactccctg
cacaagaacatggacaagatcaaggttcccacgcagatcatctgggggaagcaagaccag
gtgcttgatgtgtctggggcggatgtgttggctaagtcaatcaccaactgccaggtggag
cttctggaaaactgtgggcactcggtggtgatggagagacccaggaagacagccaagctc
atggtcgactttctagcctctgtgcacaacacagacaacaacaagaagctggactga

DBGET integrated database retrieval system