KEGG   Oryctolagus cuniculus (rabbit): 100355944Help
Entry
100355944         CDS       T03373                                 

Gene name
CFB
Definition
(RefSeq) complement factor B
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04610  Complement and coagulation cascades
ocu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100355944 (CFB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100355944 (CFB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100355944 (CFB)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     100355944 (CFB)
Peptidases and inhibitors [BR:ocu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100355944 (CFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin VWA Sushi VWA_2 DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100355944
NCBI-ProteinID: XP_002714337
Ensembl: ENSOCUG00000029682
UniProt: G1SS69
Position
12
AA seq 764 aa AA seqDB search
MGSTLSPRLCLAPLFLVLLSGGVTATPLPEAQPQSPCSLEGVEIKGGSFQLLQEGQALEY
VCPSGFYPYPVQTRTCRSMGSWSPLRTQDQKTVAKAECRAIRCPKPQDFENGDYWPRSPY
YNVNDEISFHCYHGYTLRGSANRTCQVNGRWDGQTAICDDGAGYCPNPGIPIGTRKAGSR
YRLEDTVTYHCSQGLTLRGSQQRTCQEGGSWSGTEPSCQGSFMYDTPQEVAEAFLSSLTQ
TLEGVDAEDGHSPGELQKRKIVLDPAGSMNIYLVLDGSDSIGASNFTGAKRCLVNLIEKV
ASYGVRPRYGLVTYATYPNVLVRVSDPKSSDANWVTEKLNQISYEDHKLKTGTNTKRALV
EVYNMMSWPGDVPPEGWNRTRHVIILMTDGLHNMGGDPVTVINEIRDLLNIGKDRKNPRE
DYLDVYVFGVGPLVEPANINALASKKENEQHVFRVKDMEHLEDVFFQMIDESQSLGLCGM
VWEHREGTDYHKQPWHAKISVTRPQKGHENCMGAVVSEYFVLTAAHCFTVDDQKHSIKVS
VGGKRRDLEVEEVLFHANYNINGKKAEGIPEFYDYDVALVKLKSKLTYSQTLRPICLPCT
EGTTRALRLPQSTTCQQHKEELLPAKNVKALFVSEEEKKLTRKEVYIKNGDKKASCERDA
QYAPGYDKVKDISAVVTPRFLCTGGVDPYADPNTCRGDSGGPLIIHKRSRFIQVGVISWG
VVDVCKDHKRRLQAPAYARDFHINLFQVLPWLKDKLKDEDLGFL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggggagtacgctcagcccccgactctgcctcgcacccttgttcttggtcctcttgtct
ggaggtgtgactgcgactcccttgcctgaagcccagccccaaagcccctgctctctagaa
ggggtggagatcaaaggcggctccttccaacttctccaggagggccaggcactggagtat
gtttgtccctctggcttctacccgtaccctgtgcagacacgcacttgcagatccatggga
tcctggagccccctgaggacccaagatcaaaagactgtcgccaaggccgagtgtagagca
attcgctgcccaaaacctcaggactttgagaatggggactactggccccggtctccctac
tacaatgtgaatgatgagatctctttccactgctaccatggttacactctccggggctct
gccaatcgcacctgccaggtgaatggccggtgggatgggcaaaccgccatctgcgacgat
ggagcggggtactgccccaacccaggcattccgatcggcacaaggaaggcgggcagccgg
taccgtcttgaagacactgtcacctaccactgcagtcaggggcttaccctgcgcggctcc
cagcaacgaacatgccaggaaggtggctcctggagtgggacagagccttcctgccaaggc
tccttcatgtacgacacccctcaagaggtggcggaagccttcctgtcttccctaacacag
actttagaaggagttgatgctgaggacgggcacagcccaggggaactgcagaagcgcaag
attgtcctggaccccgccggctccatgaacatctacctggtgctggacggctcagacagc
atcggggccagcaacttcacaggggccaagaggtgtctcgtcaacttgattgagaaggtg
gcgagttatggggtgaggccaagatatggcctagtgacatatgccacataccccaatgtt
ctggttagagtgtcggatccaaagagcagtgatgcaaactgggtcacagagaagctcaat
caaatcagttatgaagaccacaagctgaagacagggactaacaccaagagggccctcgtg
gaagtgtacaacatgatgagctggccaggggacgtgccccctgaaggctggaaccgcact
cgccacgtcatcatcctcatgactgacggcttgcacaacatggggggcgacccagtcact
gtcattaatgagattcgggatttgctaaacattggcaaggatcgcaaaaacccgagagag
gattacctggacgtctatgtgtttggggttgggcctctggtggagccagcgaacatcaat
gccctggcttccaagaaggagaacgagcaacatgtgttcagagtcaaggacatggagcac
ttggaggacgttttcttccagatgattgatgaaagccagtccctggggctctgtggcatg
gtgtgggagcacagggaaggcaccgactaccacaagcaaccatggcatgccaagatctca
gtcactcgccctcagaagggacatgagaactgcatgggggctgtggtgtctgagtacttc
gtgctaacagcagcacactgtttcacagtggacgaccagaagcactcaatcaaagtcagc
gtgggagggaagaggcgggacctggaggtagaagaagttctatttcacgccaactacaac
atcaatgggaaaaaggcagaaggaatccccgagttttatgactacgatgtagccctggtg
aagctcaagagtaagctgacatacagccagactctcaggcccatctgcctgccctgcacg
gaggggaccactcgagccttgcggcttcctcagtcaaccacctgccaacaacacaaggaa
gagctgctccctgcgaagaacgtcaaggctctgtttgtgtctgaggaggagaagaagctg
actcgcaaggaagtttacatcaagaatggggataagaaagccagctgcgagagggatgct
caatacgctcctggctatgacaaagtcaaggacatctcggcggtagtcacccccaggttc
ctctgcactggaggagtggatccctacgctgaccccaatacttgcagaggtgactctggt
gggcctctgatcattcacaagaggagtcgcttcattcaagttggtgtcatcagctgggga
gtagtagatgtctgcaaagaccacaagcggcgcctgcaggcacctgcttatgcccgggac
tttcatatcaacctcttccaagtgctgccctggctcaaggacaaactcaaagatgaggat
ctgggttttctgtaa

DBGET integrated database retrieval system