KEGG   Oryctolagus cuniculus (rabbit): 100356219Help
Entry
100356219         CDS       T03373                                 

Gene name
PARP16
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 16
  KO
K00774  poly [ADP-ribose] polymerase 16 [EC:2.4.2.30]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100356219 (PARP16)
Enzymes [BR:ocu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     100356219 (PARP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP ARTD15_N
Motif
Other DBs
NCBI-GeneID: 100356219
NCBI-ProteinID: XP_002718023
Ensembl: ENSOCUG00000007306
Position
17
AA seq 322 aa AA seqDB search
MQSSGRAAAREAAGRDVLAADLRCSLFASALQSYKRDSVLRPFPASYARHDCKDFEALLA
DASRLPNLKELLQSSGDNDKRAWDLVSWILSSKALTIHSAGKAEFEKIQKLTGAPHTPVP
APDFLFEIEYFDPANAKFYETKGERDLIYAFHGSRLENFHSIIHNGLHCHLNKTSLFGEG
TYLTSDLSLALIYSPHGHGWQRSLLGPILSCVAVCEVIDHPDVKCQTKKKDSKEIDRRRA
RIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKQAKRASSQLSWFASHWFTVMLSLYLL
LLLVVSVISSSAFQHFWNRAKR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctcgggcagggcggccgccagggaggctgcgggccgcgacgtgctggccgcc
gacctccggtgcagcctcttcgcctcggccctgcagagctacaagcgcgactcggtgttg
cggcctttccccgcgtcctacgcccgccacgactgtaaggactttgaggccctgcttgca
gatgccagcaggttacccaacctgaaagagctactccagtcctcgggcgacaacgacaag
cgggcctgggacctggtgagctggattttatcctccaaggccctgacgatccacagtgct
ggcaaggcagagtttgaaaagatccagaagctgactggggcccctcatacacctgtgcct
gcaccggacttcctgtttgaaatcgagtacttcgacccagccaatgccaaattttatgag
accaaaggagagcgagacctcatctatgccttccatggcagccgcctggagaacttccat
tccatcatccacaatggcctgcactgccacctcaacaagacgtccttgttcggagagggg
acctacctcaccagtgacttgagcctggccctcatttacagcccccacggccacgggtgg
cagcgcagcctccttggccccatccttagctgtgtggccgtgtgcgaggtcatcgaccat
ccagatgtcaagtgccaaaccaagaagaaggattccaaggagatagaccgcagaagagcg
agaatcaaacacagcgaaggcggagacatccctcctaagtactttgtggtcaccaacaac
cagctcctgcgggtgaagtacctgctggtgtactcgcagaagcaggccaagagggcttcg
agccagctctcctggtttgccagccattggtttacggtcatgctgtccctgtatctgctg
ctgctgctcgtcgtaagtgtcatcagttcctcggctttccagcacttctggaatcgtgcg
aagagataa

DBGET integrated database retrieval system