KEGG   Oryctolagus cuniculus (rabbit): 100358192Help
Entry
100358192         CDS       T03373                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00010  Glycolysis / Gluconeogenesis
ocu00562  Inositol phosphate metabolism
ocu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100358192 (MINPP1)
   00562 Inositol phosphate metabolism
    100358192 (MINPP1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100358192 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100358192 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 SID
Motif
Other DBs
NCBI-GeneID: 100358192
NCBI-ProteinID: XP_017204269
Position
18
AA seq 486 aa AA seqDB search
MLRASGRRLGAAVAPAVALVAGMLSSLVCCSLLGPSDPVASVLSPYFGTKTRYEDVNPRL
VLDPEVXTCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQARGRGSAGGRDLGAALADW
PLGYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLLTSSKHRCVDSGAAF
LQGLWQHYHPGLPPPDVADMECGPPRINDKLMRFFDHCEKFLTEVERNATALYHVEAFKT
GPEMQNILKKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDARVLE
YLNDLKQYWKRGHGYTINSRSSCTLFQDIFQHLDKAVEQKQRLEKFSNLLPVFSKSQPIS
SPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLYH
CENAKTPKEQFQVQMLLNEKVLPLAHSQETVSLYEDLKNYYKDILQGCQNSEECELPKVN
STSDEL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgcctccggccgccgcctcggggccgccgtagcacctgccgtggccctggtt
gcggggatgctctcatctctcgtgtgctgctctctcctggggcccagtgacccagtggcc
tcggtgttgagcccctactttggcaccaagactcgctacgaggatgtcaaccccaggctg
gttttggaccccgaggtgnncacctgcaccccggtgcagctggtcgccctcatccgccat
ggcacccgctaccccacggctaaacagatacgcaagctgaggcagctgcacgggctgctg
caggcccgcggccgcggcagtgcgggcggtcgcgacctgggcgccgcgctggccgattgg
cccctggggtacgccgactggatggacgggcagctggtggaaaagggacggcaggacatg
cgacagctggcgctacgcctggcatcgctgttcccggccctcttcagccgggagaactac
ggccgcctccgtctcctcaccagctccaagcaccgctgcgtggacagcggcgccgccttc
ctgcaggggctgtggcagcactaccaccctgggttgccgccgccggacgtcgcagatatg
gagtgtggacctccaaggattaatgataaattgatgagattctttgatcattgtgagaag
tttttaactgaagtggaaaggaatgctacggctctttatcacgtagaagccttcaaaact
ggaccagaaatgcagaacattttaaaaaaagttgcagctactttgcaagtgccagtaaat
gatttaaatgcagatttaattcaggtagctttttttacctgttcatttgacctggcaatt
aaaggtgttaagtctccttggtgtgatgtttttgacatagacgatgcaagggtattagaa
tatttaaatgacctgaaacagtactggaaaagaggacatggctatactattaatagtcga
tccagttgcaccttgtttcaggatatcttccagcacttagacaaagcagttgaacagaag
caaagattagagaaattcagcaacttgcttcctgttttctcaaagtctcaaccgatttct
tctccagtcattctccagtttggtcatgcagagacccttctaccactgctttctctcatg
ggctacttcaaagacaaggagcccctgacagcttataattataaggaacaaatgcatcgg
aagttccgaagtggtcacattgtaccttatgcctcaaacctgatatttgtgctttaccat
tgtgagaacgctaagactcctaaagaacaattccaagtgcagatgttgctgaatgaaaag
gtgttacccttggctcactcacaggaaactgtttctttgtatgaggatctgaagaactac
tacaaggacatccttcagggttgtcagaacagtgaagaatgtgaattaccaaaggtgaac
agtacatctgatgagctgtaa

DBGET integrated database retrieval system