KEGG   Oryctolagus cuniculus (rabbit): 100359228Help
Entry
100359228         CDS       T03373                                 

Gene name
SNCA
Definition
(RefSeq) synuclein alpha
  KO
K04528  alpha-synuclein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    100359228 (SNCA)
   05012 Parkinson disease
    100359228 (SNCA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100359228 (SNCA)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    100359228 (SNCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synuclein
Motif
Other DBs
NCBI-GeneID: 100359228
NCBI-ProteinID: XP_002717046
Ensembl: ENSOCUG00000023825
UniProt: G1U0V2
Position
15
AA seq 140 aa AA seqDB search
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTK
EQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQQGKSEEGAPQEGILEAMPMDP
DSEAYEMPSEEGYQDYEPEA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgttcatgaaagggctttcaaaggccaaggagggagttgtggctgccgctgag
aaaaccaaacagggtgtggcagaggctgcagggaagacaaaagagggtgttctctatgta
ggttccaaaaccaaggagggagttgttcatggtgtgacaacagtggctgagaagaccaaa
gagcaagtgacaaatgttggagaggcagtggtgacaggtgtgacagcagtcgcccagaag
acagtggaaggagcggggagcattgcagccgccaccggcttcgtcaaaaaagaccagcaa
ggcaagagtgaagaaggagccccacaggaaggaattctggaagctatgcccatggatcct
gacagtgaagcttatgaaatgccctcggaggaagggtatcaagactatgaacctgaagcc
taa

DBGET integrated database retrieval system