KEGG   Tepiditoga spiralis: OSSY52_03930
Entry
OSSY52_03930      CDS       T06810                                 

Gene name
oraS
Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
ocy  Tepiditoga spiralis
Pathway
ocy00472  D-Arginine and D-ornithine metabolism
ocy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    OSSY52_03930 (oraS)
Enzymes [BR:ocy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     OSSY52_03930 (oraS)
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A RNR_Alpha
Other DBs
NCBI-ProteinID: BBE30252
UniProt: A0A7G1G894
Position
431827..432195
AA seq 122 aa
MKERIDDFKERSKHLQNMTDEQLEKYFWELVEKTVNPMVELAEKHTTKSIERSVLLRMGF
NSLQAAALVDKIFEKNLLSKGAGHVIWKVAKNNNLDVIEAGKQMIEGKYWEEAVELFKGG
EK
NT seq 369 nt   +upstreamnt  +downstreamnt
atgaaagaaagaattgatgattttaaagaaagatcaaaacatcttcaaaatatgacagat
gaacaacttgaaaaatacttttgggaattagttgaaaaaactgtaaatccaatggtagaa
cttgcagaaaaacatacaacaaaatcaatagaaagatctgtacttttaagaatggggttc
aattcattacaagcagctgctcttgttgacaaaatctttgaaaagaacttactttcaaaa
ggagcaggacatgtaatatggaaagtagcaaaaaataataaccttgatgtaattgaagca
gggaaacaaatgatagaaggaaagtattgggaagaagctgttgaacttttcaaagggggc
gaaaaataa

DBGET integrated database retrieval system