KEGG   Tepiditoga spiralis: OSSY52_03940
Entry
OSSY52_03940      CDS       T06810                                 

Gene name
oraE
Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
ocy  Tepiditoga spiralis
Pathway
ocy00472  D-Arginine and D-ornithine metabolism
ocy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ocy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    OSSY52_03940 (oraE)
Enzymes [BR:ocy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     OSSY52_03940 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: BBE30253
UniProt: A0A7G1G633
Position
432195..434375
AA seq 726 aa
MDLKPNEKLDVNEILKDLESYVPRRKGWAWRKHVDEAKKHDFTYYQTSEDLKNSVPLPSA
HYFGNIDPQPDEVITSEIASGKFEEDIRRMRMAAWHGADHIMVIRTLGQSHIDGLIEGTP
EGIGGIPITRKQLRASRKACDLIEDEIGRPINFHSYVSGVAGPEIAVLFAEEGVNAAHQD
PQYNVLYRGINPIRSFVDAAAAKHVMASVDMLQIDGAHNANASAKKAWNVMPELIVQHGI
NCMFSVKAGMKKDLISLSTVPPTTVPSPEFRMNLIYALTLREVMRDYKFRAQMNTRYIEA
DLFDATRIHTLNTVLSRLTSADIQSTITPDEGRNVPWHINSIRGVETAKHALISLDGIKK
YVKIDEEAVRPEIRELKMRAILMLEEIQEMGGYFEAVEDGIFVDNGNYPERHGDGIKRPK
NGGIGAGTIVPRDEDYFAPVSAHFGYNKLPEGIEKPEDAIGGDTLHKPEKIQYIDELDEN
DNVNTRLKEVNENRAKGLIKPEVEWSYDGVIQLDMTIPDTPEYAEAAAIEICKKMNLEEI
QVISKTVLHPTEGTYVELRAKVPFFVKRDELTLPKKPDLLEEDVLFDFFKKHPTKVVAGT
VGNDEHNVGMREILDIKHGGIEKYGVKYTYLGTSVPPEKMIDAAIETGASAILASFIVTH
SDVHVENMKKLHELAIEKGIRDKVLIIVGGTQLNNDIAVENHMDAGFGRGTKGIHVATYL
CKQLQK
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggatttaaaaccaaatgaaaagttagatgtaaatgaaatattaaaagatttagaaagt
tacgttccccgaagaaaaggatgggcatggagaaaacatgttgatgaagcaaaaaaacat
gattttacatactatcaaacatctgaagatttaaaaaactctgttccactaccatctgct
cattactttggaaatattgatccacaaccagatgaagtaataacttcagaaatagcttct
ggaaagtttgaagaagacataagaagaatgagaatggctgcatggcatggtgcagatcat
ataatggttataagaacacttggtcaaagccatattgatggtttaatagaaggaacacct
gaaggtataggtggaataccaataacaagaaaacaattgagagcttcaagaaaagcttgt
gatttaatagaagatgaaattggtagacctattaattttcacagttatgtttctggagtt
gctggccctgaaatagctgtattatttgctgaagaaggagtaaacgcagctcatcaagat
ccacaatacaatgttttatacagaggaattaatcctataagatcatttgttgatgcagct
gctgcaaaacatgtaatggcatctgttgatatgcttcaaatagatggtgctcataatgca
aacgcttctgcaaaaaaggcttggaatgttatgcctgaattaatagttcaacatggtata
aactgtatgttttctgttaaagctggtatgaaaaaagatttaatatctttatcaacagtt
ccaccaacaacagttccatcaccagagtttagaatgaatttaatctatgcattgacctta
agagaagttatgagagattataagtttagagcacaaatgaatacaagatatatagaagct
gatttatttgatgcaacaagaattcatacattgaatacagtcctttcaagattaacttca
gcagatatacaatcaactattacaccagatgaaggtagaaatgttccatggcatataaat
tctataagaggtgtagaaactgctaaacatgctttaatatctcttgatggaatcaaaaaa
tatgtaaagatagatgaagaagctgtaagacctgaaataagagaattaaagatgagagca
atattaatgcttgaagaaattcaagaaatgggtggatactttgaagctgttgaagatggt
atttttgtagacaatggtaactatccagaaagacacggagacggcattaaaaggcctaag
aatggcggtataggtgcaggaacaattgttccaagagatgaagattactttgcacctgtt
tcagcacattttggatacaataaattacctgaaggtatagaaaaaccagaagatgctatt
ggcggagatacgcttcataaaccagaaaaaatacaatatatagatgaacttgatgaaaat
gacaatgtaaacacaagactaaaagaagtaaatgaaaatagagcaaaaggtttaataaaa
ccagaagttgaatggagttatgatggagtaattcaactcgatatgacaataccagataca
ccagaatacgctgaagctgcagcaattgaaatatgtaaaaaaatgaaccttgaagaaatt
caagttataagtaaaaccgtacttcatccaacggaaggtacatacgttgaattgagggca
aaggttccattctttgtaaaaagagatgaattaaccttacctaaaaaaccagatttactc
gaagaagatgtattgtttgatttctttaaaaagcatccaacaaaagtagtagcaggaact
gtaggaaatgatgaacacaacgttggtatgagagaaatacttgatataaaacatggtgga
attgaaaagtatggagttaaatacacatatcttggaacatctgttcctcctgaaaaaatg
attgacgctgcaatagaaacaggtgcaagtgcaatacttgcttcatttatagtaacacac
agcgatgttcatgtagaaaatatgaaaaaacttcatgaacttgcaattgaaaaaggtata
agagataaagttttaataatagtaggtggaacacaattaaataatgatatagccgtagaa
aatcatatggatgctggatttggaagaggaacaaaaggaattcacgttgcaacttattta
tgtaaacaattacaaaaataa

DBGET integrated database retrieval system