KEGG   Orrella dioscoreae: ODI_R1901Help
Entry
ODI_R1901         CDS       T05133                                 

Definition
(GenBank) COG0613, Predicted metal-dependent phosphoesterases (PHP family)
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
odi  Orrella dioscoreae
Brite
KEGG Orthology (KO) [BR:odi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ODI_R1901
Enzymes [BR:odi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     ODI_R1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: SOE49185
UniProt: A0A1C3K1U2
Position
I:2063086..2063934
Genome map
AA seq 282 aa AA seqDB search
MRTAVPLIYDLHCHSTVSDGLLAPEAVAERAYANGVNVWALTDHDEIGGLARAGDAARAV
GMRFVTGVEISVTWASQTVHIVGLAFDPADAAMAAGLADTRAGRARRAKQMGERLAAMGM
PGAYEGALPFAGNPELISRTHFARYLVDAGYCPDVQTVFNKILGDDCPGHVPMQWATLAQ
AVAWIHGAGGRAVIAHPGRYKYSPVQFGALFDEFRDLGGEGIEVVTGSHRPDQYREYADV
ARHYGFLASCGSDFHGPGESRHDLGSLPPLPAGLKPVWHDWA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccgctgtccccctcatctacgacctgcattgccattccaccgtctccgacggg
ctgctcgccccggaagcggtggcggaacgcgcctatgcgaatggcgtgaacgtgtgggcg
ttgaccgaccacgatgaaatcggcgggctggcgcgcgcgggcgatgccgcgcgggcggtg
ggcatgcggttcgtgaccggggtggaaatttccgtgacctgggccagccagaccgtgcac
atcgtgggcctggccttcgatcctgccgatgccgcgatggcggccggcctggccgatacg
cgcgccggccgtgcgcgccgggcgaagcagatgggcgagcgcctggctgcgatgggcatg
ccgggcgcctatgaaggcgccttgcccttcgccggcaatccggagctgatcagccgcacg
cactttgcgcgctacctggtcgacgcggggtattgccccgacgtgcagaccgtcttcaac
aagatcctgggcgacgactgccccgggcacgtgcccatgcagtgggccacgctggcccag
gcggtggcgtggatccacggcgcgggcggacgggccgtgatcgcccatccgggccgctat
aaatattcccccgtgcagttcggcgcgctgttcgatgagttccgggacctgggcggggag
ggcatcgaagtggtgaccggcagccaccgtcccgatcaataccgcgaatacgcggacgtc
gcgcggcactatggcttcctggcctcttgcggctcggacttccacgggcccggcgaaagc
cgccatgacctgggcagcctgccgccgctgcccgccggcctgaaacccgtctggcacgac
tgggcttga

DBGET integrated database retrieval system