KEGG   Orrella dioscoreae: ODI_R2424Help
Entry
ODI_R2424         CDS       T05133                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
odi  Orrella dioscoreae
Pathway
odi00010  Glycolysis / Gluconeogenesis
odi00020  Citrate cycle (TCA cycle)
odi00620  Pyruvate metabolism
odi01100  Metabolic pathways
odi01110  Biosynthesis of secondary metabolites
odi01120  Microbial metabolism in diverse environments
odi01130  Biosynthesis of antibiotics
odi01200  Carbon metabolism
Module
odi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:odi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ODI_R2424
   00020 Citrate cycle (TCA cycle)
    ODI_R2424
   00620 Pyruvate metabolism
    ODI_R2424
Enzymes [BR:odi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ODI_R2424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA Peptidase_M23 HlyD_D23 CAT
Motif
Other DBs
NCBI-ProteinID: SOE49965
UniProt: A0A1C3JY68
Position
I:complement(2605588..2607285)
Genome map
AA seq 565 aa AA seqDB search
MSNTVEIKVPDIGDFDSVEVIEVLVSEGDTIQAEQSLITVESDKASMEIPASEGGVVKSI
KIKVGDKVAKGSVIVEVEAAAGGKADAAPAKEAKEAPATEDSKASAAPRQETQEAKAEAP
AKAASGGVVDVAVPDIGDFDSVEVIEVLVAEGDSIKAEQSLITVESDKASMEIPSSHAGV
LTSLKVKVGDKVAKGSIIAQVEAAGDSAPAKEAPKAAKPEAAAAPAKADAGRAEASAPAP
AKEAPAQALKADVVDDAKQRLAHASPSVRKFARELGADLSKVQGSGPKGRITQDDVRGYV
KKVLAGQGAGAPAAAGGADGAALGLLPWPKVDFTKFGPVEAKPLSRIKKISGANLHRNWV
MIPHVTNNDEADITDLEALRVTLNKENEKSGVKVTMLAFLIKAVVAALKKFPEFNASLDG
DNLVLKQYYHIGFAADTPNGLVVPVIRDADKKGVAELAQLTSELAKKARDGKLSPSEMQG
GCFSISSLGGIGGTHFTPIINAPEVAIMGVSRSYHKPVWNGKEFQPRLTLPLSLSYDHRV
IDGASAARFNAYVGALLADFRRIVL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatacggtggaaatcaaagtgccggacatcggcgacttcgactcggtggaagtg
atcgaagtgctggtgtccgaaggcgacacgatccaggccgaacagagcctgatcacggtc
gagtccgacaaggcctccatggaaatccccgcctccgaaggcggcgtggtgaagtccatc
aagatcaaggtcggtgacaaggttgccaagggcagcgtcatcgtcgaggtcgaggctgcc
gcgggcggcaaggccgacgccgcgccggccaaggaagccaaggaagcgcctgccacggaa
gacagcaaggcctcggccgcgcccaggcaggaaacccaggaagccaaggccgaggcaccg
gccaaggccgcttcgggcggcgtggtcgacgtggccgtgccggacatcggcgacttcgac
tcggtcgaggtcatcgaggtgctggtcgccgaaggcgacagcatcaaggccgagcaaagc
ctgatcaccgtcgagtccgacaaggcctcgatggaaatcccgtcctcgcacgccggcgtc
ctgacgtcgctgaaagtgaaggtgggcgacaaggtcgcgaagggcagcatcatcgcccag
gtcgaggccgccggtgattcggcgcccgccaaggaagcccccaaggccgccaagcccgag
gccgccgccgcgccggccaaggccgatgccggccgcgccgaagccagcgcgcccgcgccg
gccaaggaagcgcccgcccaggccctgaaggccgacgtcgtggacgatgccaagcagcgc
ctggcgcatgcttcgccgtcggtgcgcaagttcgcccgcgagcttggcgccgacctgagc
aaggtccagggctccggtcccaagggccgcatcacgcaggacgacgtgcgtggctacgtg
aagaaggtgctggcaggccagggcgctggcgccccggccgccgccggcggcgccgatggc
gcggccctgggcctcttgccgtggccgaaggtggacttcaccaagttcggtccggtcgaa
gccaagccgctgtcgcgcatcaagaagatctccggcgcgaacctgcaccgcaactgggtc
atgatcccgcacgtcaccaacaatgacgaagcggacatcaccgacctggaagcgctgcgc
gtcacgctgaacaaggagaacgagaagtcgggcgtgaaggtcaccatgctggccttcctg
atcaaggccgtcgtcgcggccctgaagaaattccccgagttcaacgcctcgctggacggc
gacaacctggtattgaagcagtattaccacatcggtttcgccgccgacacgccgaatggc
ctggtggtgccggtcatccgcgacgccgacaagaagggcgtggccgaactggcgcaactg
acgtccgaactggccaagaaggcccgcgacggcaagctgtcgccctcggaaatgcagggc
ggctgcttctcgatctcgtcgctgggcggcatcggcggcacgcacttcacgcccatcatc
aatgcgcctgaagtggccatcatgggtgtgtcgcgctcgtatcacaagcctgtctggaac
ggcaaggaattccagccgcgcctgacgctgccgctgtcgctgtcctatgaccaccgcgtc
atcgacggcgcctcggccgcgcgcttcaacgcctatgtcggcgcgctgctggcggacttc
cgccgcatcgtgctgtaa

DBGET integrated database retrieval system