KEGG   Orrella dioscoreae: ODI_R3776Help
Entry
ODI_R3776         CDS       T05133                                 

Definition
(GenBank) Amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
odi  Orrella dioscoreae
Pathway
odi00330  Arginine and proline metabolism
odi00360  Phenylalanine metabolism
odi00380  Tryptophan metabolism
odi00627  Aminobenzoate degradation
odi00643  Styrene degradation
odi01100  Metabolic pathways
odi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:odi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ODI_R3776
   00360 Phenylalanine metabolism
    ODI_R3776
   00380 Tryptophan metabolism
    ODI_R3776
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ODI_R3776
   00643 Styrene degradation
    ODI_R3776
Enzymes [BR:odi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     ODI_R3776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: SOE51905
UniProt: A0A1C3K2Y6
Position
I:4118580..4119764
Genome map
AA seq 394 aa AA seqDB search
MLLDHDPARSFLPYPAVQVPHAPQGPLAGLDFGVKDLFDVAGYPTGGGNPHVLARSGIKA
VNAAAVQLALDAGARCVGKTHTDELAFSINGRNAHFGTPRNGAAPDRIPGGSSSGSASAV
SNGLCDFALGTDTGGSVRVPANHCGLYGIRPTHGRIPLTGSLDLAPSLDTCGVLARDADV
FARACAALLGEDAQQRGQPRLMLAEDVYALLEPEVRAVHAPLLEALAARPQGLARATVAQ
PSFDALFTAFRHVQGHEAWQVDGALIDGDGLQLGPGVKERFAFSREVTDAQYTQYSAARA
RFRDTLAALLGEDGVLVLPTMPDVAPRLDEAEETLDAYRNRALRMLCLAGLSGFPQVSVP
ALRRLDAPLGVSLLGPAGSDRWLIGQALALLPAA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcgatcacgatcccgcccgcagtttccttccctatcccgccgtgcaggtgccg
cacgccccacaggggccgctggccggcctggactttggcgtgaaggatctcttcgacgtc
gcgggctatcccaccggcggcggcaatccacatgtcctggcgcgctctggcatcaaggcc
gtcaatgccgcggcggtgcagcttgcgctggacgcgggcgcgcgctgtgtcggcaagacg
cataccgacgaactcgccttctccatcaacggccgcaacgcgcacttcggcacgccccgc
aacggcgccgcgccggatcgcatcccgggaggctccagctcggggtcggcctcggccgtc
tccaacgggctgtgcgacttcgcgctgggcaccgacaccggcggctcggtgcgggtgccg
gccaaccactgcggcctgtatggcatccgccccacccatggccgcatcccgctgacgggc
agcctggacctggcccccagcctcgacacctgcggcgtgctggcccgcgatgccgatgtc
ttcgcgcgggcttgcgccgccctgctgggcgaggacgcgcagcaacgcggccagccccgg
ctgatgctggccgaggatgtctacgccttgctggaacccgaggtccgcgcggtgcacgcg
cccctgctggaagcgctggctgcgcgcccgcaaggcctggcgcgcgccacggtggcccag
ccttccttcgacgcgctcttcaccgcgttccgtcacgtgcagggccacgaggcctggcag
gtcgacggcgcgctgatcgacggcgacggcctgcagctgggccctggcgtgaaggagcgc
ttcgcgttctcgcgtgaggtcaccgacgcgcaatacacgcaatacagtgcggcgcgcgca
cgctttcgcgacaccctggctgccctgctgggcgaggacggcgtgctggtgctgcccacg
atgccggatgtcgccccgcgtctcgacgaagccgaggaaacgctggatgcctaccgcaac
cgggcgctgcgcatgctgtgcctggcaggcctgtccggctttccgcaggtgtcggtgcct
gcgctgcggcgcctggatgcgccgctcggcgtctcgttgctgggaccggcgggcagcgac
cgctggctgatcgggcaggcgctggcgctgcttcctgccgcctga

DBGET integrated database retrieval system