KEGG   Orrella dioscoreae: ODI_R4078Help
Entry
ODI_R4078         CDS       T05133                                 

Definition
(GenBank) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
odi  Orrella dioscoreae
Pathway
odi00270  Cysteine and methionine metabolism
odi00920  Sulfur metabolism
odi01100  Metabolic pathways
odi01110  Biosynthesis of secondary metabolites
odi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:odi00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ODI_R4078
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ODI_R4078
Enzymes [BR:odi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     ODI_R4078
    2.3.1.46  homoserine O-succinyltransferase
     ODI_R4078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase
Motif
Other DBs
NCBI-ProteinID: SOE52327
UniProt: A0A1C3JZ18
Position
I:complement(4468340..4469671)
Genome map
AA seq 443 aa AA seqDB search
MTPVSVSVPAGEPACATSGAPAVHSPVSADAPPAPGSVGRVSPQFIAFDEPLQLSSGQTL
AAYELAVETYGTLNAERSNAVLICHALNASHHVAGISASDPKDIGWWDNMVGPGKPVDTN
RYFVIGVNNLGSCFGSTGPASINPATAKPWGAAFPVLTVEDWVRAQARVADHFGIARFAA
VMGGSLGGMQALGWAVTLPERVAHCVVIASTARLSAQNIGFNEVARRAIITDPDFHGGDY
YAHNTVPRRGLSVARMIGHITYLSDDDMAEKFGRAQREPAESGAYRYGYDVEFEVESYLR
YQGEKFSRYFDANTYLLITRALDYFDPARTHGGDLSAALASATADFLLVSFSTDWRFPPE
RSRELVRALLKNGTSTTYAEIDAPHGHDAFLLEDSRYHAVVSGYFDRIARAQGLPERDAA
AAAVAARATTASTPAPAAAEVSA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgactcctgtatccgtttccgttcccgccggggaacccgcttgcgccacctctggcgcg
cccgctgtccactcccccgtttccgctgatgcgccgccggctcccggttcggtcggccgg
gtctcgccccagttcatcgccttcgacgagccgctgcaactgtccagcggccagacgctg
gcggcctacgaactggcggtggaaacctatggcacgctgaacgccgagcgcagcaatgcg
gtgctgatctgccatgcgctgaacgcctcgcaccacgtcgcgggcatctcggcgtccgac
ccgaaggacattggctggtgggacaacatggtgggcccgggcaagcccgtggacaccaat
cgctatttcgtcatcggcgtgaacaacctgggctcgtgcttcggctcgacggggccggcc
agcatcaatccggccacggccaagccctggggcgccgccttcccggtgctgacggtggag
gactgggtgcgcgcgcaggcccgcgtggccgaccacttcggcatcgcgcgcttcgcggcg
gtgatgggcggttcgctgggcggcatgcaggcgctgggctgggcggtgacgctgcccgag
cgggtggcgcactgcgtggtgatcgccagcacggcgcgcctgtcggcgcagaacatcggt
ttcaacgaggtggcacgccgcgccatcatcaccgatcccgacttccacggcggcgattac
tacgcgcacaacacggtgccgcgccgcggcctgtcggtggcgcgcatgatcggccacatc
acgtacctgtcggatgacgacatggccgagaagttcggccgcgcgcagcgcgagcccgcc
gaaagcggggcataccgctatggctacgacgtggagttcgaggtcgagtcctacctgcgc
taccagggcgagaagttctcgcgctatttcgacgcgaacacctatctgctgatcacgcgc
gcgctggattatttcgacccggcccgcacgcatggcggcgatctgtccgccgcgctggcc
tcggccacggccgatttcctgctggtgtcgttctcgaccgactggcgcttcccgcccgag
cgttcgcgcgagctggtgcgcgcgctgctgaagaacggcacgtccacgacctatgccgag
atcgacgcgccgcacggccatgacgccttcctgctggaagacagccgttatcacgcggtg
gtgtccggctatttcgaccgcatcgcccgtgcgcaggggctgcccgagcgcgacgcggct
gccgccgcggtggcagcgcgggcgacgaccgcatccacgcccgcgcccgccgcggcggag
gtttccgcatga

DBGET integrated database retrieval system