KEGG   Orrella dioscoreae: ODI_R4225Help
Entry
ODI_R4225         CDS       T05133                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
odi  Orrella dioscoreae
Brite
KEGG Orthology (KO) [BR:odi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ODI_R4225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: SOE52483
UniProt: A0A1C3K694
Position
I:complement(4636323..4636697)
Genome map
AA seq 124 aa AA seqDB search
MKSYDLTVTVTPRYVSDQSDPAQRQYVFAYTVRITNTGERPAQVIARHWIITDGEQRQQE
VRGLGVVGQQPLLAPGETFEYTSGCPLPTPVGTMRGAYHCVGENGIPFDVPISEFVLAMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcctacgacctcaccgttaccgtgacgccccgctatgtctccgaccaatcggac
ccggcccagcggcagtatgtgttcgcctatacggtgcgcatcaccaacacgggcgaacgg
ccggcgcaggtcatcgcgcggcactggatcatcaccgatggcgaacagcgccagcaggaa
gtgcgcggcctgggcgtggtggggcagcagccgctgctcgcgcccggcgaaaccttcgaa
tacaccagcggctgtccgctccccaccccggtgggcacgatgcgcggcgcctatcactgc
gtgggcgagaacggcattccgttcgacgtaccgatctccgaattcgtgctggccatgcct
cgcacgctgcattga

DBGET integrated database retrieval system