KEGG   Orrella dioscoreae: ODI_R4402Help
Entry
ODI_R4402         CDS       T05133                                 

Definition
(GenBank) Ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
odi  Orrella dioscoreae
Pathway
odi00040  Pentose and glucuronate interconversions
odi00053  Ascorbate and aldarate metabolism
odi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:odi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ODI_R4402
   00053 Ascorbate and aldarate metabolism
    ODI_R4402
Enzymes [BR:odi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     ODI_R4402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: SOE52681
UniProt: A0A1C3K6F5
Position
I:4831000..4832586
Genome map
AA seq 528 aa AA seqDB search
MSLTGNMLIGAQTVRGEGRPLHAINPATGEKLEPGFPAGTAADVNRAAELAQAAFDVYRN
VPLETRAQFLETIAQNILDLGDALPERAHLETGLPLARLQGERGRTVGQLRLFARVIRDG
YFLDATIDPALPERQPLPRADLRLANVPMGPVVVFGASNFPLAFSVAGGDTASALAAGCP
VIVKAHNAHPGTSELVGRAIQAAVAKHGLPEGTFSLMFGSGNEIGTALVAHPAIQAVGFT
GSRRGGLALLATANARDVPIPVYAEMSSINPVFLLPAALEARGDAIARGFVDSLTMGVGQ
FCTNPGLVIGIEGPALDRFRDAAAKAVADKGAATMLTPGIFSAYEEGSQALAKHGDVKEI
GRGAASNPACNAAGPVVFSAQADRFLASRELEAEVFGPASLVVACKDLAQVKAVAEHLEG
QLTATLFVDDADIAQARELLPVLERKAGRILANGYPTGVEVSHAMVHGGPFPATSNGATT
SVGATAIRRFLRPVCYQDLPDALLPEGLKRENPLGLPRLVDGTLQAGK
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaccggcaacatgctcatcggcgcgcaaaccgtgcgcggtgaaggccgcccc
ctgcatgccatcaaccccgccaccggcgagaagctggagccgggctttcccgccggcacc
gccgccgacgtgaaccgcgccgccgagctggcccaggccgccttcgacgtctatcgcaac
gtgccgctggagacccgcgcgcagttcctggaaaccatcgcccagaacatcctggacctg
ggtgatgcgctgcccgaacgcgcccacctggaaaccggcctgccgctggcccgcctgcag
ggcgagcgcggccgcaccgtcggccagctgcgcctgttcgcgcgcgtgatccgcgacggc
tacttcctggacgccaccatcgaccccgccctgcccgagcgccagccgctgccgcgcgcc
gacctgcgcctggccaacgtgccgatgggtccggtcgtcgtcttcggcgccagcaacttc
ccgctggccttctccgtcgccggcggcgacaccgcctcggccctggccgccggctgcccc
gtcatcgtgaaggcgcacaacgcccaccccggcacctcggaactggtgggccgcgccatc
caggccgccgtcgccaagcacggcctgcccgaaggcacgttctcgctgatgttcggctcg
ggcaacgagatcggcaccgccctggtcgcccatcccgccatccaggccgtgggcttcacc
ggctcgcgccgtggcggcctggccctgctggccaccgccaatgcccgcgacgtgccgatc
cccgtctacgccgagatgtccagcatcaaccccgtgttcctgctgcccgccgcgctggaa
gcgcgtggcgacgccatcgcacgcggcttcgtcgactcgctgacgatgggcgtgggccag
ttctgcaccaaccccggcctggtcatcggcatcgaaggtccggcgctggaccgtttccgc
gacgccgccgccaaggccgtcgccgacaagggcgccgccaccatgctgaccccgggcatc
ttcagcgcctatgaagaaggctcgcaagccctggccaagcacggcgacgtgaaggaaatc
ggccgcggcgctgcctccaaccccgcctgcaacgccgccggcccggtcgtgttctcggcc
caggccgaccgcttcctggcctcgcgcgaactggaagccgaagtcttcggccccgcctcg
ctggtcgtcgcgtgcaaggacctcgcgcaggtcaaggccgtcgccgagcacctggaaggc
cagctgaccgcgacgctcttcgtggacgacgccgacatcgcccaggcccgcgagctgctg
cccgtgctggaacgcaaggccggccgcatcctggccaatggctaccccaccggcgtggaa
gtcagccacgccatggtgcacggcggccccttccccgccacgtccaacggcgccacgacc
tcggtcggcgccacggccatccgccgcttcctgcgcccggtctgctaccaggacctgccc
gacgcgctgctgcccgaaggcctgaagcgcgaaaacccgctgggcctgccgcgattggtg
gacggcacgctgcaagccggcaagtaa

DBGET integrated database retrieval system