KEGG   Oerskovia sp. KBS0722: FFI11_008615Help
Entry
FFI11_008615      CDS       T06124                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
oek  Oerskovia sp. KBS0722
Pathway
oek03010  Ribosome
Brite
KEGG Orthology (KO) [BR:oek00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FFI11_008615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:oek03011]
    FFI11_008615
Ribosome [BR:oek03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FFI11_008615
  Bacteria
    FFI11_008615
  Archaea
    FFI11_008615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QDW62592
Position
1916251..1916622
Genome map
AA seq 123 aa AA seqDB search
MEAKAQARFVRVTPQKARRVVDLIRGKQATEAVAVLKFAPQAASEPIRKVVESAIANARV
KADRASVAFDEQELVVAQAFVDEGPTLKRFRPRAQGRASQILKRTSHITVVLVPREDTKG
RAR
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaggcgcaggcgcggttcgtccgtgtcacgccccagaaggcccggcgcgtc
gtggacctcatccgtggcaagcaggccaccgaggccgtcgcggtgctgaagttcgcaccg
caggccgcgagtgagccgatccgcaaggtcgtggagagcgcgatcgcgaacgcacgggtg
aaggccgaccgcgcgagcgtggcattcgacgagcaggagctcgtcgttgcccaggcgttc
gtggacgagggcccgaccctcaagcggttccggcctcgcgctcaggggcgcgcgagccag
atcctcaagcggacgagccacatcaccgtggttctcgttccgcgcgaagacacgaaggga
agggcccgatag

DBGET integrated database retrieval system