KEGG   Olea europaea var. sylvestris (wild olive): 111365312Help
Entry
111365312         CDS       T05244                                 

Definition
(RefSeq) PTI1-like tyrosine-protein kinase At3g15890
Organism
oeu  Olea europaea var. sylvestris (wild olive)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 111365312
NCBI-ProteinID: XP_022841527
Position
17
AA seq 367 aa AA seqDB search
MNFFTTFCCVKGSDRKKQGKKELTWRVFSLKELQLATNNFNYDNKLGEGGFGSVYWGQLW
DGSQIAVKRLKSWSDKAEMEFSVEVEILARVRHKNLLTLRGYCAEGQERLIVYDYMINLS
LLSHLHGPHSAECHLDWNRRMNIAVGAAEGIAYLHNYATPHIIHRDIKASNVLLDGDFQA
QVADFGFAKFIPEGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKK
PLEKLSLRIKRSITDWALPLAREGKFNELVDLRLTGKYVEEELKRVVLVGLVCSHNQPEK
RPTMLEVIELLKGDREKFAALEMHEMFKSSPEMFKSSPVLEENSDTISDEKEPKQEIENV
EVLTTGH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaattttttcaccacgttttgttgcgtcaagggttcggatcggaaaaaacaagggaag
aaggagcttacatggagggttttttctctgaaggaattgcaattggccacaaacaatttt
aactacgacaacaagctcggagaaggtggatttggcagtgtttattggggtcagctttgg
gatggttctcaaattgctgtgaaaaggttaaagtcctggagtgacaaagcagagatggaa
ttttctgttgaagtcgagattcttgctcgagtacggcacaagaatttgcttactttacgt
ggttactgtgctgaagggcaagaacgtcttattgtctatgattacatgattaatctgagc
ttactgtctcatcttcatgggccacattctgctgaatgccatcttgactggaaccggcgg
atgaacattgctgttggggctgccgagggcattgcctatttacataactacgcaacaccc
cacattatacaccgagatattaaagctagcaacgtattgctagatggagattttcaagct
caagttgctgattttggatttgcaaagttcatacccgaaggtgcaacacatgtaaccacc
agagttaagggtactcttggctatcttgccccggaatatgcaatgttaggaaaggcatca
gaaagctgcgatgtttacagctttggcattcttttgcttgagcttgctagtggaaagaaa
cccctagagaagctcagtttgagaataaaacgatcaatcacggattgggccctacctctg
gcacgcgagggaaaattcaacgaacttgtggatttgaggctcactgggaagtatgtggaa
gaagagttgaaaagggttgtccttgtaggactcgtatgtagtcataatcaacccgagaag
cgaccaacaatgcttgaagtgattgaacttctaaaaggagacagagagaagtttgcagct
ctggaaatgcacgaaatgttcaaaagcagtccggaaatgttcaaaagcagtccggtttta
gaggaaaactcagatactatctcagacgaaaaggaaccgaaacaagaaattgaaaatgtt
gaagttctaaccactggacattaa

DBGET integrated database retrieval system