KEGG   Olea europaea var. sylvestris (wild olive): 111366735Help
Entry
111366735         CDS       T05244                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oeu01001]
    111366735
Enzymes [BR:oeu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111366735
Protein kinases [BR:oeu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111366735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kinase-like YukC ABC1 APH
Motif
Other DBs
NCBI-GeneID: 111366735
NCBI-ProteinID: XP_022843202
Position
18
AA seq 353 aa AA seqDB search
MVINLAMKILIGIPFVFGLLVYKLRTRHLSTFNAIENFLRSQNNLMPISYSYSDIKKMTK
GFREKLGEGGYGSVYKGKLRSGRDVAVKILGKNKSNGQDFINEVTTTGRIHHVNIVRLVG
YCADMSHCALVYDFMPNGSLEKYLCCKKSGIHSLTWEKKQAITLGVAQGIEYLHRGCDMR
ILHFDIKPHNILLDDNFTPKISDFGLAKSYSNETSIVTITAARGTIGYVAPELINRGIGA
VSYKADVYSFGMLLMEMLSLKKNLIQNTELSSQYFPDWIYDHFNKSKDLEIGDAEELGCE
ERKITRKMTIVALWCIQMNPVDRPSMSKVMEEKFREKFNLVRGGFYTDEVQGS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcaaccttgctatgaagatcttaattggaattccattcgttttcggattactt
gtctataaactgagaacaagacacttatcaacgtttaatgcaatagaaaactttctacgc
agtcagaataacctgatgcctatcagttactcctattcagacataaagaaaatgaccaaa
ggtttccgtgaaaaattgggtgaagggggttatggttcagtttacaaaggaaagcttcga
agtggaagggatgtagcagtgaaaatactaggcaaaaataaatcaaatggacaagatttc
atcaatgaagttaccactaccggaagaattcatcatgtcaatatagttcgacttgttggt
tattgtgcagatatgtcccattgtgctcttgtatatgacttcatgcctaatggttcactt
gagaagtatctctgttgtaagaaaagtggaattcattcattaacttgggagaaaaagcaa
gcgattacacttggagttgctcaagggattgaatatttgcatcgaggttgtgacatgcga
attctgcatttcgatattaagccacacaacatacttctcgatgataacttcactccgaaa
atttctgatttcgggctagccaaatcttactcgaatgaaactagtattgtaactattact
gctgcacgaggtacaattggttatgtagctcccgagttgatcaacagaggcattggggct
gtctcctacaaggcagatgtttatagcttcggaatgttgttgatggaaatgttaagtcta
aagaaaaacttgatacaaaacacggaactttctagccaatacttccccgattggatatat
gatcatttcaacaagagtaaggatcttgaaattggagatgctgaggaattaggctgtgaa
gaaaggaagattactaggaagatgacaatagttgcattatggtgcatacagatgaatcct
gtagatcgtccttcaatgagtaaagtaatggaggagaaatttcgggaaaaatttaatctt
gttcgtggaggtttttatacagatgaagttcaaggcagttag

DBGET integrated database retrieval system