KEGG   Olea europaea var. sylvestris (wild olive): 111367800Help
Entry
111367800         CDS       T05244                                 

Definition
(RefSeq) putative receptor-like protein kinase At5g39000 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oeu01001]
    111367800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Malectin_like Malectin Pkinase_fungal Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 111367800
NCBI-ProteinID: XP_022844628
Position
18
AA seq 1171 aa AA seqDB search
MFNLVFFFLYPLLCTLAVHSADNYLTGDIAINCGSTGISIAFNNKEWTGDITESKSTSSL
VIKGSSTASTAFHNFVSTDPIPYKTARISRKQFSYTFQVSPGQKLIRLHFSLASYQRYKK
FKDLFTVEAGAFTLLRNFSASLTADALGVKSLVKEYCMNIEQNQPLSIIFSPEHSQSDKT
YAFINGIEVLSMPSDLYYSHDDDDLGARVVGQKSRFYVDNSTALEIMQRLNFKWDPIPYL
GMFGKWATVPDEKIKDFTWKTSVDVGFGYLLRLHFCERGLQMAETRNSVFSVSINDMIAE
TNVAIGKERSVVSGIHLHRDYMVMVKGNKEDGRRDLSISLQLKDELVTELFRGLEILKLS
NHDNSLASPNPSPPRRSSKSATVQNLLSFFGHGNAIATGAVIIISLVNIITYKLRKIWED
NCTDSGYKPSGLTEKLCRPFSLTEIQSATENFNDALVIGRGGFGKVYRGFISKEQKIVAI
KRLKSNSRQGAREFWTEVETLSQLQHTNIISLIGYCNECQEMILLYEYVPSGTLADHLFG
LSGQSDYHSSLSWEQRLRICTGVGRGLDYLHTGTDQGIIHRDIKASNILLDENLEAKISD
FGLAKARKRNRVQSYVSTNVKGTYGYFDPDYFRTRRLRRKSDTYAFGVVLLEVLCERPAL
DRRVEEDKQRILAIWAQDCISKGEIDRLVAPSLRAQISPESLMTFLEVAKRCLHDEPNKR
PTMAQVVVQLESALEQQESSKSSAPEITSSDSVVPRAGETLHSINTEIEEMSSVDEQNMP
LSLTERSKMVQYTEPSGREAQVYKKNKIAYKLPRFRLWNALWKRANIIKKTHLSIPAHFG
EEVASYRFDLATIVAATNNFSQPNKIGEGGFGPVYKGLLSTGQEVAVKRLASNSHQSFIE
FKNEVLLLSKLQHPNLIKLLGYCIHGEELILVYEFMENKSLDAYLFGETSHKLGWTIRFK
IAIDIARGILHLHQDSGLRIIHRDIKVSNILLDKEMNPKISGFCLASTLEEHQAEMETLR
VVGTYGYISPEYAIEGVFSVKSDVFSFGVVVLEILHGRKVYGFPRAVDPVERVWKMWNEG
KALEFLDKSMKDEFLADEALRCIQVGLLCVQNRPGDRPTMQSVLEMLEGEVLSLPQPLPP
AYVENGTYSSLKMSTHIDATNEVTITELECR
NT seq 3516 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatctagtcttcttcttcctttatcctcttctttgcaccttagcagttcattcc
gcagataattacctcacaggggatatagctattaactgtggttcaactggcatttcaatc
gccttcaataacaaggaatggactggagatataacagaatcaaaatctacttcctcacta
gtgataaaaggctcatccaccgcttcaactgccttccataatttcgtttcaacagatccc
attccctacaagacagctcgaatctctcgcaagcaattctcctacacgtttcaagttagt
ccaggtcagaaacttattcgtcttcacttcagtttggcttcttaccaacgttacaaaaaa
tttaaggatttgttcactgtcgaagccggggctttcaccctccttagaaactttagtgct
tcactaactgctgatgccctcggcgtgaagtctttggttaaggagtattgcatgaatata
gaacagaatcaacctctgagtataattttctctcctgaacacagtcaatctgataaaaca
tatgcttttataaatggaatagaggtattatccatgcctagtgatctttattactctcat
gatgatgatgatcttggagcccgagtggttggccaaaaatctcgattctatgtcgataac
agcactgcgcttgaaattatgcagcgattaaatttcaaatgggaccctattccttatctt
ggcatgtttgggaaatgggcaacagttccagatgaaaagatcaaagattttacctggaaa
acgtctgtggatgttggattcggatacttgctcaggcttcatttctgcgagaggggactt
cagatggcagagactagaaacagcgtattcagtgtctccataaatgacatgattgcagaa
actaatgttgctattggcaaagagaggagcgtcgtcagtggaatccatttgcacagagac
tatatggtgatggtgaaaggaaacaaagaagatggcaggcgtgatctatcaatttccctg
cagttaaaggatgaattggtaactgaactcttcagaggattggagatattgaagttgagc
aaccacgataatagtcttgcaagtccaaacccctcccctcccagacgatcttcaaaatct
gctacagtgcaaaatttactgtcattttttggtcatggaaatgcaattgctactggtgca
gtaattataatctccctagtcaacatcattacttataagttgcggaaaatttgggaagat
aactgtaccgactctggatacaagccatcaggcttgactgaaaaactatgtcgtcctttt
tcgcttactgagatccaatcagctactgagaacttcaatgatgcacttgttattgggagg
ggtggatttggcaaagtatacagaggatttattagtaaggagcaaaagattgtagccata
aaacgattaaaatccaattccaggcaaggggcgcgcgagttttggacagaggtcgaaacc
ctttcgcagctccaacatactaatatcatttctttaatcggatactgcaatgaatgccaa
gaaatgatccttctctatgaatatgttcctagtggcacattggctgaccatctctttgga
ctcagtggacagagtgattatcactcctctctctcttgggagcagcgactgaggatctgc
actggggtaggccgaggattagactaccttcacactggcactgatcaaggaatcatacac
cgtgacataaaggcttcgaacatcctgctggatgaaaatttggaggctaagatttcagat
tttgggttggccaaagctcgaaagagaaatcgggtgcaaagctatgtcagcactaacgtt
aaaggtacatatgggtattttgacccagactatttcagaactcgtagattgagaaggaag
agtgacacatatgccttcggggttgtgttgttggaagtactgtgcgaaagaccagcactg
gatcgaagagtcgaagaggataagcagaggatcctcgccatttgggctcaagattgcatc
agcaaaggagaaattgatcgccttgttgctccaagtctgagggcacaaatatcaccagag
agcctgatgacatttcttgaagttgctaaaagatgcttgcatgacgaaccaaataaacgg
cctacaatggctcaagttgtggtacaacttgagtctgcactggagcaacaggaaagctca
aaatcttctgctccagagataactagttctgatagtgtcgtgcctcgtgctggggaaact
ctacattcaattaacaccgagatagaagaaatgtcctctgtggatgagcagaatatgcca
ctctctctgactgaaagaagcaaaatggttcagtataccgagccatcaggcagagaagca
caagtgtataagaaaaacaaaattgcttataagctaccacgatttcggctatggaatgca
ttatggaaaagggcaaacataataaagaaaacccatttatcaataccagcacattttgga
gaggaagttgcatcgtatagatttgatctggctacaattgtagctgcaactaataacttt
tcgcaaccgaataagattggagaaggtggatttggtcctgtttataagggtctgttatct
acaggacaggaagtagctgttaaaaggttggcatcgaatagccaccaaagctttattgaa
tttaaaaatgaagtccttttgctttccaaacttcagcatccaaacctcattaaactactc
ggatattgcattcatggagaagaattaatacttgtatatgagttcatggagaacaaatct
ctagatgcttacttatttggtgaaacaagtcataaacttggatggaccatacgtttcaaa
atcgctattgatattgctcgtggaattcttcatcttcatcaagattcaggattgagaatt
attcacagggatatcaaagtaagtaatattttacttgacaaagagatgaaccctaaaatt
tctggtttctgtctagcaagtactttagaagaacatcaagctgaaatggaaaccttgagg
gttgttgggacatatggttatatatctccagaatatgccatagaaggtgtattctcagtt
aagtcggatgtgtttagttttggagttgttgtcctagagattctgcatggaagaaaagtc
tatggttttcctagagctgttgaccctgttgagcgtgtctggaagatgtggaatgaagga
aaagccttagaatttttagataaatcaatgaaggatgagtttctagcagatgaagcacta
agatgtatacaagttggacttttatgtgtccaaaatcgaccaggagatcgaccaacaatg
caatcagtgctagagatgttggaaggagaagttctgtcgttgccacaaccattaccacct
gcatatgttgaaaatggaacatattctagtttgaagatgagcactcacattgacgctacc
aatgaagtaactattactgagttagagtgtcgatag

DBGET integrated database retrieval system