KEGG   Olea europaea var. sylvestris (wild olive): 111368466Help
Entry
111368466         CDS       T05244                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic-like
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00030  Pentose phosphate pathway
oeu00480  Glutathione metabolism
oeu01100  Metabolic pathways
oeu01110  Biosynthesis of secondary metabolites
oeu01200  Carbon metabolism
Module
oeu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
oeu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111368466
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111368466
Enzymes [BR:oeu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     111368466
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     111368466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 111368466
NCBI-ProteinID: XP_022845478
Position
19
AA seq 488 aa AA seqDB search
MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETLDRAHREGNLPLSGQ
YNPRDFVLSIKKPRSVIILVKAGAPVDQTIAALAAHMEPGDTIIDGGNEWYEDTERRISE
ASNKGLLYLGMGVSGGEDGARNGPSLMPGGSHEAYLNIRNILEKVAAQVDDGPCVAYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLGNDDLAGIFEEWNRGELESFLIEIT
SDIFRVKDEETGNGGLVDKILDKTGMKGTGKWTVQQAAELSIAAPTIAASLDSRYMSGLK
EERVAASEIFKKEGLKEDINNVGVVDKKRLIDDVRQALYASKICSYAQGMNLLRAKSVEK
GWNLNLGELARIWKGGCIIRAVFLDRIKQAYQRNPGLANLLVDPEFAREMVQRQAAWRRV
VGLAIQKGISVPGMSASLQYFDTYRRGRLPANLVQAQRDYFGAHTYERIDCPGSFHTEWS
KLARKARV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggaatctgccgcactgtcgcaaattgggctagccggcctggctgtgatgggacaaaat
ctagccctgaacattgccgagaagggatttcctatctccgtctacaaccggacaacctcc
aaagtcgatgagaccctagatcgggcccaccgtgaaggtaatctccctctctccggccag
tacaatcccagagattttgtgctttctataaaaaaacctaggtcggtaatcatcttagtt
aaagccggcgcacctgttgaccagactattgcggctctggcagcacatatggagcctggt
gatacgattattgatggagggaatgaatggtatgaagatactgagaggcgcatttcggag
gcgtcaaataaaggccttctttatctaggcatgggggtttcgggaggtgaggatggggca
cgtaatgggccgtcattgatgccgggagggtcgcacgaggcttatttgaatattcgtaat
atattggagaaggtcgcggcacaggtggatgatgggccttgtgttgcatatattggagaa
ggggggtcgggaaattttgtgaaaatggttcataatgggattgagtatggtgatatgcag
ttgatttcagaggcatatgatgttttgaagaatgttggggggttggggaatgatgatttg
gctgggatttttgaggagtggaataggggggaattggagagtttcttgattgagattact
tcagatatcttcagggtgaaggatgaagagactgggaatggggggttggtggataagatt
ttggataaaaccgggatgaaaggaactgggaaatggacagttcagcaggctgctgagctg
tcaatagctgcgcccaccattgcagcttcattagatagtagatatatgagtgggttgaag
gaggagagagtggctgcatcggagatttttaagaaggaagggttaaaggaggatattaat
aatgtgggcgtagtggataagaagaggttgatcgacgatgtaagacaggcgttatatgcc
tcaaagatttgtagttacgcccaagggatgaacttgttgagggcaaagagcgtggaaaaa
ggatggaatttgaatttgggggagctggcaaggatttggaaaggtgggtgcattattagg
gcagtgttcttggataggattaagcaggcctatcaaaggaacccaggcctggctaattta
ttagtcgacccagaatttgctcgggagatggttcagaggcaagctgcatggagaagagtt
gtagggttggcaattcagaagggaataagcgttcctgggatgtctgcaagtttgcaatat
tttgatacctatagacgtggaaggcttcctgcaaaccttgtgcaggctcagagggactac
tttggggcacatacgtatgagaggattgattgtccgggatcattccatactgagtggtca
aagctcgcccggaaggccagagtttaa

DBGET integrated database retrieval system