KEGG   Olea europaea var. sylvestris (wild olive): 111369590Help
Entry
111369590         CDS       T05244                                 

Definition
(RefSeq) probable methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
oeu  Olea europaea var. sylvestris (wild olive)
Pathway
oeu00450  Selenocompound metabolism
oeu00970  Aminoacyl-tRNA biosynthesis
oeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oeu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111369590
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111369590
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oeu01007]
    111369590
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oeu03016]
    111369590
Enzymes [BR:oeu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111369590
Amino acid related enzymes [BR:oeu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111369590
Transfer RNA biogenesis [BR:oeu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111369590
 Prokaryotic type
   Other AARSs
    111369590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e C1_1
Motif
Other DBs
NCBI-GeneID: 111369590
NCBI-ProteinID: XP_022846941
Position
20
AA seq 618 aa AA seqDB search
MADHNPPAAGAATKVPVDGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRMRGY
NCIYVCGTDEYGTATETKAMEENCSPKEICDKYHAIHKEVYEWFNISFDEFGRTSSFKQT
EICHAIFKKLLENNWLSENTMQQLFCDKCQRFLADRFVEGNCPTPGCNYDSARGDQCEKC
GKLLNPTELLDPRCKVCQNTPHIRDTNHLFLELPLLKDKLEDYINSMSVAGGWSQNAIQA
THAWLREGLKARCITRDLKWGVPVPLEKFKDKVFYVWFDAPIGYVSITSCYTTEWEKWWK
NPENVELYQFMGKDNVPFHTVMFPSTLLGTGENWTLMKTISVTEYLNYEAGKFSKSKGVG
VFGNDAKYTNIPVEVWRYYLLANRPEVSDTLFTWTDLQAKLNSELLGNLGNFINRVLSFI
AKEPGSGYGSIIPDAQGAESHSSTKALGEKVGSYVELYIEAMEQVKLKQGLKMAMSISSE
GNAYLQESQFWKLYKGDRASCSVIMKTSVGLVYLLACLLEPFMPSFYRGVLAQLNLPLDL
QVSLSDGDVERAKRPWEILPAGHKIGNPAPLFKEMKREEVGLFREKFAGSQADRIAKAEA
EANKTADKLEETKISGAS
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcataatcctcccgccgccggcgccgccaccaaggttcccgttgacgggaag
cggaacatactcattactagcgccttgccgtacgtcaacaacgtacctcatcttggaaat
atcatcggctgcgtgttgagtgctgatgtgtttgcaaggtactgtagaatgaggggttac
aactgcatatatgtatgcggaacagatgagtatgggacggcgactgagactaaggccatg
gaggagaactgttctccaaaagaaatttgtgacaaatatcatgccattcataaagaagta
tacgagtggttcaatataagctttgatgagttcggacgtacatcaagttttaagcagact
gaaatttgccatgcaattttcaagaaactgttggagaataattggctttctgaaaacacg
atgcagcagcttttctgtgataaatgtcaaagatttttagctgatcggtttgtggagggc
aattgcccaacaccgggttgtaattatgattctgcacgtggagatcaatgtgaaaagtgc
gggaagctattaaatccgactgaactactggacccaagatgcaaggtctgtcagaatact
ccacatattcgtgacacaaatcacctttttctcgagcttcccctgttgaaggacaaatta
gaggactatatcaacagcatgtcagtggctggaggatggagtcagaatgctatccaagca
acacatgcttggcttagagaagggctgaaagcacggtgtattacaagagacttgaagtgg
ggagtccctgtcccacttgagaaattcaaagacaaggttttctatgtatggtttgatgca
cctattggatatgtctcaatcacttcctgctacacaactgagtgggaaaaatggtggaag
aatcctgaaaatgttgagctttatcaatttatgggcaaggataatgtgcctttccatact
gtaatgttcccatccactcttcttggaactggtgaaaactggactttgatgaagaccatc
agtgttacagaatacttgaactatgaagcagggaaattctctaagagtaaaggtgttgga
gtttttggaaacgatgcaaaatatacgaatattcctgtagaagtatggaggtactatttg
ctggcaaataggccagaggtatcggacacattgtttacatggactgatttgcaagcaaag
ttgaacagcgagttgctgggcaatctaggaaatttcatcaatcgagtcttgagtttcata
gcaaaagaacctggttcaggatatggctccatcattcctgatgctcagggtgcagagtca
cattcatcaacaaaggcattaggagaaaaagttggcagttatgttgagctgtatatagaa
gcaatggaacaggtgaaactaaagcaaggcttgaagatggctatgtcgatttcaagtgaa
ggaaacgcttatttgcaagagagccaattctggaagctttacaagggagatcgagcttca
tgttctgtcattatgaagacatcagtcggattagtatatctccttgcatgtctcttagaa
cctttcatgccatccttttaccgcggggtacttgcacagctcaatttgcctcttgacctt
caagtttcactttctgatggtgatgttgaaagggctaaaagaccctgggagattctacct
gctggtcataaaattggaaatccagcaccattgttcaaagaaatgaaaagggaagaagtt
gggttattcagagagaaatttgctggaagtcaagctgataggattgcaaaagcagaagct
gaagcaaataaaactgctgataaactggaggaaacaaaaatctcaggggcatcttaa

DBGET integrated database retrieval system